MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint korkhov-2012-1 Asymmetric states of vitamin B₁₂ transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Korkhov VM., Mireku SA., Hvorup RN., Locher KP. FEBS Lett. (0014-5793) 2012 imex curation Only protein-protein interactions korkhov-2012-2 Asymmetric states of vitamin B₁₂ transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Korkhov VM., Mireku SA., Hvorup RN., Locher KP. ATP and AMP-PNP were used as competitors to the agarose-ATP to prove that the BtuCDF complex binds ATP. FEBS Lett. (0014-5793) 2012 imex curation Only protein-protein interactions korkhov-2012-3 Asymmetric states of vitamin B₁₂ transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF. in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Korkhov VM., Mireku SA., Hvorup RN., Locher KP. FEBS Lett. (0014-5793) 2012 imex curation Only protein-protein interactions btud_ecoli Vitamin B12 import ATP-binding protein BtuD btuD b1709 Vitamin B12-transporting ATPase JW1699 protein protein ecoli Escherichia coli (strain K12) MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAYGMNFRRLDIEGHRMLISTI btuc_ecoli Vitamin B12 import system permease protein BtuC btuC b1711 JW1701 protein protein ecoli Escherichia coli (strain K12) MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLKAGR btuf_ecoli Vitamin B12-binding protein yadT btuF b0158 JW0154 protein protein ecoli Escherichia coli (strain K12) MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) btuc-btud-1 1274112 btud_ecoli BtuD 1274115 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 btuc_ecoli BtuC 1274116 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 btuf_ecoli BtuF 1274117 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false selenomethionine se(s)met L-selenomethionine Delta:S(-1)Se(1) Se(S)Met Selenium replaces sulphur semetm undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false mint t1 f2a f2b f2c f4 3.4A Rworking = 0.21 Rfree = 0.25 btuc-btud-2 1274113 n/a 1274118 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) btuf_ecoli BtuF 1274117 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 btud_ecoli BtuD 1274115 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 btuc_ecoli BtuC 1274116 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig.s 1c, 1d, 2d btuc-btud-3 1274114 btud_ecoli BtuD 1274115 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified P06611:p.Glu159Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 n/a 1274118 enzyme target enzyme target substrate substrate neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) btuc_ecoli BtuC 1274116 predetermined predetermined participant predetermined ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 btuf_ecoli BtuF 1274117 predetermined predetermined participant predetermined ancillary ancillary neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 atpase reaction atpase reaction false false false Fig. 1b