matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE http://matrixdb.ibcp.fr boucas-2012-1 Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. in vitro In vitro cleavage cleavage assay cleavage weight by staining molecular weight estimation by staining weight by staining Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br Matrix Biol. (0945-053X) 2012 imex curation boucas-2012-2 Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. in vitro In vitro enzymatic study enzymatic study weight identificat confirmation by molecular weight weight identificat Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br Matrix Biol. (0945-053X) 2012 imex curation hep1_pedhe Heparin lyase I protein protein pedhe Pedobacter heparinus MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADSAKQKAIIDNKWVAVGINKPYALQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQNAQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEIKTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFSKGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWITFDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKFGIYRVGNSTVPVTYNLSGYSETAR heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hep1-heparin 1311470 n/a 1311472 enzyme enzyme neutral component neutral component pedhe Pedobacter heparinus n/a UHF 1311473 enzyme target enzyme target substrate substrate neutral component neutral component pig-gastric mucosa Sus scrofa gastric mucosa gastric_mucosa gastric mucosa cleavage cleavage reaction cleavage false false false 1C hep1-heparin-1 1311471 n/a 1311472 enzyme enzyme neutral component neutral component pedhe Pedobacter heparinus n/a UHF 1311473 enzyme target enzyme target substrate substrate neutral component neutral component pig-gastric mucosa Sus scrofa gastric mucosa gastric_mucosa gastric mucosa cleavage cleavage reaction cleavage false false false 1D