MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2012m-1 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. nicbe Nicotiana benthamiana complementation protein complementation assay PCA complementation predetermined predetermined participant predetermined Li Z., Liu D. FEBS Lett. (0014-5793) 2012 li-2012m-2 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Liu D. FEBS Lett. (0014-5793) 2012 li-2012m-3 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Liu D. FEBS Lett. (0014-5793) 2012 li-2012m-4 ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis. nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li Z., Liu D. FEBS Lett. (0014-5793) 2012 rac10_arath Rac-like GTP-binding protein ARAC10 ARAC10 ROP11 MQB2.20 MQB2.180 At5g62880 GTPase protein ROP11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVLVGTKLDLREDKHYLADHPGLSPVTTAQGEELRKLIGATYYIECSSKTQQNVKAVFDSAIKEVIKPLVKQKEKTKKKKKQKSNHGCLSNVLCGRIVTRH rogf1_arath Rop guanine nucleotide exchange factor 1 ROPGEF1 Rho of plants guanine nucleotide exchange factor 1 Kinase partner protein-like F22I13.200 At4g38430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLSSEEDDEVSSERCGSYSPSADISESESSSSFSCHRFDGEGASSSIPSSPRVVAGRGFYFPAPVMLPVIGGKDVVWDDKQPDNDLSEIEMMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAPQKKAMWRRELEWLLCVSDSIVELIPSIQQFPGGGTYEIMETRPRSDLYANLPALKKLDAMLIDMLDAFSDTEFWYTDRGIVLGDCDKDSYNSPASVRQEDKWWLPCPKVPPNGLSEEARKKLQQCRDFANQILKAALAINSGVLAEMEIPDPYLETLPKSGKECLGEIIYQYLTANKFSPECLLDCLDLSSEHQTLEIANRIEAAVHVWRQKNGRRHKKQAKLKLSSWGGKVKGLVNDNERNDFLVQRAETLLQSLRIRFPGLPQTTLDMNKIQYNKDVGQSILESYSRVMESMAFNITARIDDVLYVDDAMRRSISVTESLSLFSINGLNPQKAFSVQSSPHGSPFATPALSVASRSPRRAPPLYSVKRNGTREKGIVGETEKAWSYAGNLSSRRVTGVTPERD rogf2_arath Rop guanine nucleotide exchange factor 2 ROPGEF2 Rho of plants guanine nucleotide exchange factor 2 T1N6.8 At1g01700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENLPNHEENDDVGYHQSPGPIDPNDHSASETPVYSTMSTDSFAYHRTCSETSGGGFSDQIDETSSFCTEASPSDWPVLTESNNSASSNFPTVFDLKHNQIETDEHLAVQEISEPELETMKERFSKLLLGEDMSGSGKGVCTAVTISNAITNLYATVFGQNLRLEPLEIEQKTTWKREMNCLLSVCDYIFEFIPKSQNLSNGATVEVMESRPRADIYINLPALRKLDSMLMEALDSFQKTEFWYAEEGSLSMKSTRSATGSFRKVIVQRKEEKWWLPIPLVPLQGLSEKARKQLKSKRESTNQIHKAAMAINSSILGEMDIPDSYMATLPKSGKASTGDAIYRHMTSSGRFSPEKLLDRLKIVSEHEALQLADRVEASMYTWRRKACLNNSKSSWNMVKDLMSITERSDKNYVLAERAESLLFCLKQRYPELSQTSLDICKIHCNKDVGKAVLESYSRVLEGLAFNIVAWIDDVLYVDKTMRGEE mint rogf4_arath Rop guanine nucleotide exchange factor 4 ROPGEF4 Rho of plants guanine nucleotide exchange factor 4 F4I18.13 At2g45890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSSNSDQNEGTPTSSVSSPYRRTYSDISGLSHRFDVQSFYNRPSNTNAVVLSGHEEDVSEDAEEPKDDVVNDVHGDGDEEDSDIDSAEDAELEMMRERFAKLLLGEDMSGSGKGVCTAVTVSNSITNLYATVFGQSLRLQPLSTEKKDLWKREMNCFMSICDYIVEVIPRSLGTNVEITETKLRSDILMSLPALRKLDNMLMEILDSFTENEFWYVERGSSSMNSGGGGRDSGTFRKVVVQRKDEKWWLPVPCVPAEGLSEEERKHLRHKRDCASQIHKAALAINDSTLNDMDIPDSYLTTLPKSGKASVGDVIYKQLCTAEKFYPDQLLDILKITSEHEALELADKVEASLVTWRRKTGGLTHSKSSWDMMKDISGDADRGNDKNHILAARARSLLFCLKQRYPELSQTSLDICKIQFNRDVGKAVLESYSRVLEGLAYNVVSWIDDVLYVDRTVRNRDD mint rogf8_arath Rho guanine nucleotide exchange factor 8 ROPGEF8 Rho of plants guanine nucleotide exchange factor 8 MOB24.21 At3g24620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAALERGLSASKSFNFKRMFDSSSTKQQQSQTIVVENGDSHIVESNTPESQNSDSFVESPVESSLPMISPLTRPGKRSERQQADMEMMKDRFAKLLLGEDMSGGGKGVSSALALSNAITNLAASIFGEQTKLQPMPQDRQARWKKEIDWLLSVTDHIVEFVPSQQTSKDGVCTEIMVTRQRGDLLMNIPALRKLDAMLIDTLDNFRGHNEFWYVSRDSEEGQQARNDRTNDKWWLPPVKVPPGGLSEPSRRMLYFQKDSVTQVQKAAMAINAQVLSEMEIPESYIDSLPKNGRASLGDSIYKSITEEWFDPEQFLAMLDMSTEHKVLDLKNRIEASVVIWKRKLHTKDTKSSWGSAVSLEKRELFEERAETILVLLKQKFPGLPQSSLDISKIQFNKDVGQAVLESYSRILESLAYTVMSRIEDVLYTDTLALKQTLLAEETSDGGRTTETDSESAGSSNSGEEAEKHDPHSKTLLDFMGWNDNSSKGGDKPTKSPNLTPKKLSYLEKLENLNGFRSPKDRH mint rogf9_arath Rop guanine nucleotide exchange factor 9 ROPGEF9 Rho of plants guanine nucleotide exchange factor 9 F17N18.130 At4g13240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVPSLERGISITSSFNLDRMFDSSPGKEQQQPHLAETTMPESQTQDSLGGSPVETSRPMTSRLISRRQDKQQSETEMMKDRFTKLLLGEDMSGGGKGVSSALALSNAITNLAASIFGEQTKLQPMAPDRRARWKKEIDWLLSVTDHIVEFVPSQQISKEGVCTEIMVTRQRGDLLMNIPALRKLDAMLIDTLDNFRGHNEFWYVSRDSEEGKQARNERTKDKWWLPPVKVPPNGLSESARRMLHFQKDSVSQVQKAAMAINAQVLSEMAIPDSYIESLPKNGRVSLGDSLYKSITEEWFDPEQFLSTLDLSTEHKVLDVKNRIEASIVIWKRKLHLKDNKSSWGSAVSLEKRELFEERAETILVLLKQKFPGLPQSSLDISKIQYNKDVGHAVLESYSRILESLGYTEMSRIDDVLYADSLARKQCTGEETSDGGKIATETDSASAGSSNYSGEEIEKLESQNSSKTTLLDFIGWSDNSSKGQSEKPPKSPRMTPKKLSYLEKLENLNGFRSPKDRH mint arac10-ropgef1 1281347 rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ropgef1 ROPGEF1 1281352 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint arac10-ropgef2 1281347 rogf2_arath ROPGEF2 1281353 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint arac10-ropgef4 1281347 ropgef4 ROPGEF4 1281354 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint arac10-ropgef8 1281347 q9lv40_arath ROPGEF8 1281355 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint arac10-f17n18_130 1281347 ropgef9 ROPGEF9 1281356 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint ropgef1-arac10 1281348 ropgef1 ROPGEF1 1281352 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint ropgef2-arac10 1281348 rogf2_arath ROPGEF2 1281353 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint ropgef4-arac10 1281348 ropgef4 ROPGEF4 1281354 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint ropgef8-arac10 1281348 q9lv40_arath ROPGEF8 1281355 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint f17n18_130-arac10 1281348 ropgef9 ROPGEF9 1281356 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint arac10-ropgef1-1 1281349 rac10_arath Rop11 1281351 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ropgef1 ROPGEF1 1281352 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint arac10-ropgef4-1 1281349 ropgef4 ROPGEF4 1281354 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint arac10-ropgef1-2 1281350 rac10_arath Rop11 1281351 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ropgef1 ROPGEF1 1281352 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3C mint arac10-ropgef4-2 1281350 ropgef4 ROPGEF4 1281354 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rac10_arath Rop11 1281351 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3C mint