IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2012-4 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. zhang-2012-1 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. zhang-2012-2 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. mouse-testis Mus musculus testis testis density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. zhang-2012-3 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. zhang-2012-7 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. Skin fibroblasts were used from a human patient who is homozygous for the common BBS10 mutation, c91fsX95. This is a truncating, frameshift, mutation caused by a single-nucleotide insertion (at residue 91), leading to premature termination four codons later. (Stoetzel C et al., Nat Genet. 2006) The authors state that the mutation is predicted to result in total absence of the BBS10 protein. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. zhang-2012-8 Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome. human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Yu D., Seo S., Stone E.M., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes All interactions taken from Supplementary Figures 3 + 4 have been assumed to have been carried out in 293T cells using anti-tag antibodies. However this info has not been confirmed by the authors. Wild-type human skin fibroblasts. It has been assumed in Supplemental figures 5+ 6, that "The common BBS10 mutation, c91fs95" refers to the mutation "C91fsX95" - however this has not been confirmed by the authors. val-sheffield@uiowa.edu J. Biol. Chem. (0021-9258) 2012 Only protein-protein interactions imex curation The construct "HA-PCM1 C terminus" has been entered as " UniProt ID=Q15154 -Human PCM1 amino acids 1913-2024", as taken from reference 26 - Kim et al., Nat. Genet. 36:462-470, -and as also referenced in UniProt entry Q15154 for "Interaction with BBS4". However, this the origin and sequence info has not been confirmed by the authors. bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA pcm1_human Pericentriolar material 1 protein PCM1 protein protein human Homo sapiens Human MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRVTNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDASTNPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTLRDQHLNNSSASPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESENEGHLNPSEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEVNSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPSLDCRYNREGEQEIHVAQGEDDEEEEEEAEEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKTQKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTACPDLQLSAASVGNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRRKQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFSADENYRPLAKTRQQNISMQRQENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHFIMHQLNQCYTQLTWQQNNVQRLKQMLNELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQPVNLFNIPGFTNFSSFAPGMNFSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIGAEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLESFSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESASMSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFERETHKISEQNDADNASVLSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNMRCTCRIIEDGDGAGAGTTVNNLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDKDKDETETVKQTQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQTSLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATSKNDQNNCPVKPCYLNILEDEQPLNSAAHKESPPTVDSTQQPNPLPLRLPEMEPLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI bbip1_human BBSome-interacting protein 1 BBIP1 NCRNA00081 BBIP10 BBSome-interacting protein of 10 kDa protein protein human Homo sapiens Human MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH bbs12_human Bardet-Biedl syndrome 12 protein BBS12 C4orf24 protein protein human Homo sapiens Human MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESLDLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGLNFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVASQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRTDNTEGVSKPDGFQEHVTATHKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQQGNCTKPFMFDISRIFTCCLPGLPETSSCVCPGYITVVSVSNNPVIKELQNQPVRIVLIEGDLTENYRHLGFNKSANIKTVLDSMRLQEDSSEELWANHVLQVLIQFKVNLVLVQGNVSERLIEKCINSKRLVIGSVNGSVMQAFAEAAGAVQVAYITQVNEDCVGDGVCVTFWRSSPLDVVDRNNRIAILLKTEGINLVTAVLTNPVTAQMQIKEDRFWTCAYRLYYALKEEKVFLGGGAVEFLCLSCLHILAEQSLKKENHACSGWLHNTSSWLASSLAIYRPTVLKFLANGWQKYLSTLLYNTANYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIPRVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFLFL mkks_human McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin Bardet-Biedl syndrome 6 protein MKKS BBS6 protein protein human Homo sapiens Human MSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVTHPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRIPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVIDSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMTGTQPIGSLGSICPNSYGSVKDVCTAKFGSKHFFHLIPNEATICSLLLCNRNDTAWDELKLTCQTALHVLQLTLKEPWALLGGGCTETHLAAYIRHKTHNDPESILKDDECTQTELQLIAEAFCSALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANWPDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTLDCLTAKLSGLQVAVETANLILDLSYVIEDKN bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS ttc8_human Tetratricopeptide repeat protein 8 TTC8 BBS8 Bardet-Biedl syndrome 8 protein protein protein human Homo sapiens Human MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML tcpb_human T-complex protein 1 subunit beta CCT2 99D8.1 CCTB CCT-beta protein protein human Homo sapiens Human MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC tcpa_human T-complex protein 1 subunit alpha CCTA TCP1 CCT1 CCT-alpha protein protein human Homo sapiens Human MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND bbs10_human Bardet-Biedl syndrome 10 protein BBS10 C12orf58 protein protein human Homo sapiens Human MLSSMAAAGSVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRLLEALHLEHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLMCENIQTHGRHWKNCSRWKFISQALLTFQTQILDGIMDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYFCGRVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLVLQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFWIMEKTKAIMKHLHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIGLSPFVPPQAFSQCEIPNTALVKFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQHEDALHGALKMLRQLFKDLDLNYMTQTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDALEKTQTYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLTDYYEPLLKNNSTAYSTRGNRIEISYENLQVTNITRKGSMLPVSCKLPNMGTSQSYLSSSMPAGCVLPVGGNFEILLHYYLLNYAKKCHQSEETMVSMIIANALLGIPKVLYKSKTGKYSFPHTYIRAVHALQTNQPLVSSQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSEDEL ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML pthb1_mouse Protein PTHB1 Bbs9 Pthb1 Bardet-Biedl syndrome 9 protein homolog Parathyroid hormone-responsive B1 gene protein homolog protein protein mouse Mus musculus Mouse MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLNIGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVSSTLDSVSQATNVEPGADSVPSITVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTDRNPDGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFELRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQVIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQELGWEETVDAAIAYLLKTCLSKSSKEQALNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPGGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPEVSARQGVLE bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA bbs4_mouse Bardet-Biedl syndrome 4 protein homolog Bbs4 protein protein mouse Mus musculus Mouse MAEVKLGMKTQVPASVESQKPRSKKAPDFPIVEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQCADNLKQVARSLFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLTYIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVYQKAFEHLGNALTYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENARRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKSALAQYQEMEKKVNFLKDNSPLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKTKHRTNSGSKSATLQQPLGSIQALGQAMSSAAAYRKILSGAVGAQLPKPPSLPLEPEPEPTVEASPTEASEQKKEK bbs5_mouse Bardet-Biedl syndrome 5 protein homolog Bbs5 protein protein mouse Mus musculus Mouse MSVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 bbs2-bbs1-2 1291797 n/a 1291803 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2D bbs4-bbip1 1291797 n/a 1291805 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291803 unspecified role unspecified role prey prey Q8NFJ9:p.Met390Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2D BBS1 M390R mutant protein has greatly reduced interaction with BBS4, but normal interactions with BBS9 and BBS2. bbs9-bbs1-3 1291797 n/a 1291803 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291806 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2D bbs2-bbs7 1291797 n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2A bbs7-bbs1-2 1291797 n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291803 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2A bbs7-bbs9 1291797 n/a 1291804 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291806 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S2B -1 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs9-bbs7 1291797 n/a 1291806 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S2B -2 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs2-bbs9-1 1291797 n/a 1291806 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2B -3 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. bbs2-bbs9-2 1291797 n/a 1291807 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2B -4 BBS7 and BBS9 do not directly interact, rather they only interact in the presence of BBS2. pcm1-bbs1 1291797 n/a 1291808 unspecified role unspecified role bait bait c_terminus sufficient to bind sufficient binding region sufficient to bind range range range range false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291805 unspecified role unspecified role prey prey Q96RK4:p.Arg295Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q96RK4:p.Gly277Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4A bbs4-pcm1-9 1291797 n/a 1291808 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminus sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1291805 unspecified role unspecified role bait bait Q96RK4:p.Gly277Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q96RK4:p.Arg295Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4A bbip1-bbs4 1291797 n/a 1291808 unspecified role unspecified role unspecified role unspecified role c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291805 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig S3A bbs4-pcm1-11 1291797 n/a 1291809 unspecified role unspecified role unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291805 unspecified role unspecified role unspecified role unspecified role n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig S3A bbip1-pcm1 1291797 n/a 1291805 unspecified role unspecified role ancillary ancillary n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1291808 unspecified role unspecified role prey prey c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291809 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S3B PCM1 can interact with BBIP10 only when BBS4 is present. pcm1-bbip1 1291797 n/a 1291805 unspecified role unspecified role ancillary ancillary n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1291808 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminal_region sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1291809 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig S3B PCM1 can interact with BBIP10 only when BBS4 is present. mkks-bbs12-1 1291797 n/a 1291810 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291811 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role ancillary ancillary association association false false false S4A The interaction of BBS6 with BBS12 requires BBS7. bbs7-bbs12 1291797 n/a 1291807 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291810 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4B Although the text states:-"The interaction of BBS7 with BBS12 requires BBS6." - however there is a clearly visible band when the antibody used for IP is anti-myc, even when BBS6-siRNA is present. bbs12-bbs7-1 1291797 n/a 1291807 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291810 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291811 unspecified role unspecified role ancillary ancillary association association false false false S4B -2 The interaction of BBS7 with BBS12 requires BBS6. bbs12-mkks 1291797 n/a 1291811 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291810 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role ancillary ancillary association association false false false S4A -2 The interaction of BBS6 with BBS12 requires BBS7. bbs7-bbs12-2 1291797 n/a 1291811 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NPJ1:p.Thr57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 1291810 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4C bbs12-bbs7-2 1291797 n/a 1291807 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291810 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291811 unspecified role unspecified role ancillary ancillary region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NPJ1:p.Thr57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false association association false false false S4C-2 bbs7-bbs1 1291798 n/a 1291804 unspecified role unspecified role prey prey n/a 1291803 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291805 unspecified role unspecified role prey prey association association false false false Fig 1A The mutant BBS7T211I has a decreased ability to interact with endogenous BBSome subunits compared with WT BBS7, however it pulls down relatively more BBS2 than other BBSome proteins. bbs7-bbs1-1 1291798 n/a 1291803 unspecified role unspecified role prey prey n/a 1291804 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 1B Knockdown of BBS2 decreases the association of BBS7 with BBS1, while knockdown of BBS1 does not affect the association of BBS7 with BBS2. bbs9-bbsx 1291798 n/a 1291806 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291804 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role prey prey association association false false false Fig 1C bbip1-bbs7 1291798 n/a 1291804 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role prey prey n/a 1291803 unspecified role unspecified role prey prey n/a 1291805 unspecified role unspecified role prey prey n/a 1291809 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 1C bbs5-bbs1 1291798 n/a 1291805 unspecified role unspecified role prey prey n/a 1291812 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291803 unspecified role unspecified role prey prey n/a 1291804 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role prey prey association association false false false Fig 1C bbs5-bbs1 1291798 n/a 1291804 unspecified role unspecified role prey prey n/a 1291805 unspecified role unspecified role prey prey n/a 1291813 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291803 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role prey prey association association false false false Fig 1C bbs2-bbs1-1 1291798 n/a 1291807 unspecified role unspecified role prey prey n/a 1291804 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291805 unspecified role unspecified role prey prey n/a 1291813 unspecified role unspecified role prey prey n/a 1291803 unspecified role unspecified role prey prey n/a 1291806 unspecified role unspecified role prey prey association association false false false Fig 1D Knockdown of BBS9 greatly decreases the association of BBS1, BBS4, and BBS8 with BBS2, but does not affect the association of BBS7 with BBS2. mkks-bbs7-1 1291798 n/a 1291814 unspecified role unspecified role prey prey n/a 1291815 unspecified role unspecified role prey prey n/a 1291807 unspecified role unspecified role prey prey n/a 1291811 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5A Absence of BBS10 decreases the interaction of BBS6 with TCPalpha and TCPbeta. mkks-bbs7-3 1291798 n/a 1291816 unspecified role unspecified role ancillary ancillary region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role prey prey n/a 1291811 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291815 unspecified role unspecified role prey prey n/a 1291814 unspecified role unspecified role prey prey association association false false false Fig 5B Overexpression of BBS10 promotes the interaction of BBS6 with TCPalpha and TCPbeta. mkks-bbs2 1291798 n/a 1291811 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291807 unspecified role unspecified role prey prey n/a 1291804 unspecified role unspecified role prey prey association association false false false Fig 6A bbs2-bbs5 1291798 n/a 1291807 unspecified role unspecified role prey prey n/a 1291813 unspecified role unspecified role prey prey n/a 1291806 unspecified role unspecified role prey prey n/a 1291805 unspecified role unspecified role prey prey n/a 1291804 unspecified role unspecified role bait bait n/a 1291803 unspecified role unspecified role prey prey n/a 1291812 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A bbs7-cct2 1291798 n/a 1291807 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291814 unspecified role unspecified role prey prey association association false false false Fig 6B bbs7-cct2-1 1291798 n/a 1291804 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291814 unspecified role unspecified role prey prey association association false false false Fig 6B bbs1-bbs2-2 1291799 n/a 1291817 unspecified role unspecified role neutral component neutral component n/a 1291818 unspecified role unspecified role neutral component neutral component n/a 1291819 unspecified role unspecified role neutral component neutral component n/a 1291820 unspecified role unspecified role neutral component neutral component n/a 1291821 unspecified role unspecified role neutral component neutral component n/a 1291822 unspecified role unspecified role neutral component neutral component n/a 1291823 unspecified role unspecified role neutral component neutral component Q3V3N7:p.Met390Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig 2B, 3A. The BBS1 M390R mutation associates normally with all BBSome proteins, except for BBS4. bbs1-bbs2-5 1291799 n/a 1291822 unspecified role unspecified role neutral component neutral component n/a 1291823 unspecified role unspecified role neutral component neutral component n/a 1291820 unspecified role unspecified role neutral component neutral component n/a 1291817 unspecified role unspecified role neutral component neutral component n/a 1291819 unspecified role unspecified role neutral component neutral component n/a 1291818 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 3A. Loss of BBS4 does not affect the incorporation of other BBSome subunits (including BBS1) into the BBSome. bbs1-bbs2-4 1291800 n/a 1291822 unspecified role unspecified role prey prey n/a 1291821 unspecified role unspecified role prey prey n/a 1291819 unspecified role unspecified role bait bait n/a 1291817 unspecified role unspecified role prey prey n/a 1291820 unspecified role unspecified role prey prey n/a 1291818 unspecified role unspecified role prey prey n/a 1291823 unspecified role unspecified role prey prey Q3V3N7:p.Met390Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false association association false false false Fig 2C, 3B. Using Bbs1 M390R/M390R mutant mice, BBS1 is missing from the complex along with BBS4. bbs2-bbs1-3 1291800 n/a 1291820 unspecified role unspecified role prey prey n/a 1291817 unspecified role unspecified role prey prey n/a 1291818 unspecified role unspecified role prey prey n/a 1291823 unspecified role unspecified role prey prey n/a 1291822 unspecified role unspecified role prey prey n/a 1291819 unspecified role unspecified role bait bait association association false false false Fig 3B. Loss of BBS4 does not affect the incorporation of other BBSome subunits (including BBS1) into the BBSome. bbs1-bbs2-6 1291801 n/a 1291803 unspecified role unspecified role neutral component neutral component n/a 1291804 unspecified role unspecified role neutral component neutral component n/a 1291812 unspecified role unspecified role neutral component neutral component association association false false false Fig S6B -2 Absence of BBS10 lowers BBS2 protein levels and inhibits BBSome formation. bbs2-bbs5-2 1291802 n/a 1291807 unspecified role unspecified role neutral component neutral component n/a 1291812 unspecified role unspecified role neutral component neutral component n/a 1291804 unspecified role unspecified role neutral component neutral component n/a 1291813 unspecified role unspecified role neutral component neutral component n/a 1291806 unspecified role unspecified role neutral component neutral component n/a 1291803 unspecified role unspecified role neutral component neutral component n/a 1291805 unspecified role unspecified role neutral component neutral component association association false false false Fig S6B