mpidb The Microbial Protein Interaction Database ollis-2012a-1 The ExbD periplasmic domain contains distinct functional regions for two stages in TonB energization. ecolx Escherichia coli crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Ollis A.A., Kumar A., Postle K. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK exbb_ecoli Biopolymer transport protein ExbB JW2974 b3006 exbB protein protein ecoli Escherichia coli (strain K12) MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQKLRAG tonb_ecoli Protein TonB tonB exbA JW5195 b1252 protein protein ecoli Escherichia coli (strain K12) MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ exbd-1 1339674 not-defined-286447911 1339675 unspecified role unspecified role neutral component neutral component region P0ABV2-112-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false figure 4A exbb-exbd-3 1339674 not-defined-291930991 1339676 unspecified role unspecified role neutral component neutral component not-defined-1470182673 1339675 unspecified role unspecified role neutral component neutral component region P0ABV2-112-121 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4A exbd-p02929-4 1339674 not-defined-919901210 1339675 unspecified role unspecified role neutral component neutral component region P0ABV2-132-141 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1422111841 1339677 unspecified role unspecified role neutral component neutral component physical association physical association false false false figure 4