MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint el_magraoui-2012-1 The RING-type ubiquitin ligases Pex2p, Pex10p and Pex12p form a heteromeric complex that displays enhanced activity in an ubiquitin conjugating enzyme-selective manner. in vitro In vitro pull down pull down predetermined predetermined participant predetermined El Magraoui F., Bäumer BE., Platta HW., Baumann JS., Girzalsky W., Erdmann R. FEBS J. (1742-464X) 2012 c8zb10_yeas8 EC1118_1J11_0210g protein protein yeas8 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) MSRVAQLDSIALDKELYGQFWSEFNAAFNTSEHKEEWELALNTVVFMCATRFLPHYGSSCTYGSALSGVAFQCRKRTLYVVTVLAGYVWKKITHIIFNGPHCGNQMMWLKLYKWVNLLYHGCDVTNFLRFLAAEGPNARAFLSPLYRAFNVHSTRLIRDGSAIASEFYSNSVFAGLEYQNRQLLWNALLELFSNTLLTKRGLLTFVKNPPRSRSTTTYKTVCPRCGGFPTNPYQIACCRANYCYVCVVKALEWSMCDACGSSGRLTASPVY mint c8z5h8_yeas8 EC1118_1D0_5446g protein protein yeas8 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) MKNDNKLQKEALMRLSQLRFPFADAPSIVQAHQKDEQIQGLLIMKVTELCKLIKSQLFVNSYPKELSIFAKLLYLLFTTGRRGRTLGEEYVDLTYTNRKGTRLAGRLKMIVFAFAYPLCPYFITKLYKKIMKNNKESKIEDTESVAAFCKGLLDFILDVHMTLFYFKGAFYSISKRIFGMRYVFKHILSKNEANFREEGSQKYKVLGYILLAQNVMKWYPVLTSTLGSWIYGRKRTNDSITRSSVGLQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSCAPCGHLFCWSCLMSWCKERPECPLCRQHCQPQEILVLRQ mint c8zen3_yeas8 Peroxin-12 EC1118_1M3_1882g protein protein yeas8 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) MSFYSNLPSAGQSSRGSSTSGRNGVGLEPLYPTIFEIMSSQEIDSLLPASIRYLLANHLVANFPNRYTLRLNKYFFEWFQAIKGFVEWYHLKTYNSTFIDRFYGLQLFSSRDRNLALTQCLNPKGQSEWPQGLQLNQQQKSVIFLEKIILPYITAKLDEILEKISMNNIFSSDETENKWPKRAFLRIYPFIKKLLALSNLLVKLLFLTKRTGSVSLLQYLFKIEYTTVRPLSSELSGLKETKGMDNRLRKTNISSIFALMQGQLSIIPRFLTFMGSQFFPTFIFVLRVYQWWTTQDMTTKLQKRVNDLDEDIPRPPFSSHSDKTEDKEGVSEACPVCEKTVQNPCVLETGYVACYPCAISYLVNNEGHCPVTNKKLLGCTYNKHTNKWEVVTGIRKLLI mint c8zen3-c8z5h8 1282549 pex2p Pex2p 1282550 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex10p Pex10p 1282551 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex12p Pex12p 1282552 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f1b f4d c8zb10-c8z5h8 1282549 pex12p Pex12p 1282552 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex2p Pex2p 1282550 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pex10p Pex10p 1282551 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1c mint c8z5h8-c8zb10 1282549 pex10p Pex10p 1282551 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pex2p Pex2p 1282550 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1a mint c8z5h8-c8zen3 1282549 pex10p Pex10p 1282551 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex12p Pex12p 1282552 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1a mint c8zen3-c8z5h8-1 1282549 pex10p Pex10p 1282551 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pex12p Pex12p 1282552 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1a mint