MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint varsaki-2012-1 Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation varsaki-2012-2 Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation mbec_ecolx Mobilization protein MbeC mbeC Conjugative accessory protein MbeC protein protein ecolx Escherichia coli MIPMKRERMLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS mint mbea_ecolx DNA relaxase MbeA mbeA DNA nickase Mobilization protein MbeA protein protein ecolx Escherichia coli MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGNPEEVRELIDATPFAKKYTSGVLSFAEKELPPGGREKVMASFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELQTGKRLQPYYDRADRPRIDAWQTLVNHHYGLHDPNAPENRRTLTLPDNLPETKQALAEGVTRGIDALYHAGEIKGRQDVIQALTEAGLEVVRVTRTSISIADPNGGKNIRLKGAFYEQSFADGRGVREKAERESRIYRENAEQRVQEARRICKRGCDIKRDENQRRYSPVHSLDRGIAGKTPGRGERGDDAAQEGRVKAGREYGHDVTGDSLSPVYREWRDALVSWREDTGEPGRNQEAGRDIAETEREDMGRGVCAGREQEIPCPSVREISGGDSLSGERVGTSEGVTQSDRAGNTFAERLRAAATGLYAAAERMGERLRGIAEDVFAYATGQRDAERAGHAVESAGAALERADRTLEPVIQRELEIREERLIQEREHVLSLERERQPEIQERTLDGPSLGW mint mbea-mbec 1266595 mbec mbeC 1266597 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dna relaxase mbea mbeA 1266598 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1266595 mint t1 f2 the affinity of MbeA for ss-DNA is enhanced by the binding of MbeC to MbeA mbea-mbec-1 1266596 dna relaxase mbea mbeA 1266598 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mbec mbeC 1266597 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 mint