UniProt UniProt http://www.uniprot.org peng-2012-1 Identification of ITGB4BP as a new interaction protein of P311. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Peng X., Yuan S., Tan J., Ma B., Bian X., Xu C., He W., Cao H., Huang Z., Cui Y., Gan C., Wang X., Zhou J., Hu J., Yang S., Luo G., Wu J. junwupro1@yahoo.com Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation peng-2012-2 Identification of ITGB4BP as a new interaction protein of P311. human-adenocarcinoma Human pulmonary adenocarcinoma cell adenocarcinoma pulmonary adenocarcinoma cell fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Peng X., Yuan S., Tan J., Ma B., Bian X., Xu C., He W., Cao H., Huang Z., Cui Y., Gan C., Wang X., Zhou J., Hu J., Yang S., Luo G., Wu J. junwupro1@yahoo.com Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation peng-2012-3 Identification of ITGB4BP as a new interaction protein of P311. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Peng X., Yuan S., Tan J., Ma B., Bian X., Xu C., He W., Cao H., Huang Z., Cui Y., Gan C., Wang X., Zhou J., Hu J., Yang S., Luo G., Wu J. junwupro1@yahoo.com Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation peng-2012-4 Identification of ITGB4BP as a new interaction protein of P311. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Peng X., Yuan S., Tan J., Ma B., Bian X., Xu C., He W., Cao H., Huang Z., Cui Y., Gan C., Wang X., Zhou J., Hu J., Yang S., Luo G., Wu J. junwupro1@yahoo.com Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation peng-2012-5 Identification of ITGB4BP as a new interaction protein of P311. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Peng X., Yuan S., Tan J., Ma B., Bian X., Xu C., He W., Cao H., Huang Z., Cui Y., Gan C., Wang X., Zhou J., Hu J., Yang S., Luo G., Wu J. junwupro1@yahoo.com Life Sci. (0024-3205) 2012 Only protein-protein interactions imex curation nrep_human Neuronal regeneration-related protein NREP C5orf13 Neuronal protein 3.1 P311 Protein p311 protein protein human Homo sapiens Human MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF if6_human Eukaryotic translation initiation factor 6 EIF6 ITGB4BP OK/SW-cl.27 B4 integrin interactor CAB p27(BBP) B(2)GCN homolog EIF3A protein protein human Homo sapiens Human MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT p311-itgb4bp 1308338 n/a p311 1308343 unspecified role unspecified role bait bait n/a itgb4bp 1308344 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 eif6-nrep 1308339 n/a itgb4bp 1308344 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region cy5 label cy5 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a p311 1308343 unspecified role unspecified role fluorescence donor fluorescence donor region cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.3 p311-itgb4bp-2 1308340 n/a itgb4bp 1308344 unspecified role unspecified role prey prey region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a p311 1308343 unspecified role unspecified role bait bait cell lysate cell lysate region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.4 nrep-eif6-1 1308341 n/a p311 1308343 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a itgb4bp 1308344 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.5 eif6-nrep-1 1308342 n/a itgb4bp 1308344 unspecified role unspecified role neutral component neutral component if6 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a p311 1308343 unspecified role unspecified role neutral component neutral component cell lysate cell lysate p311 rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig.4