mpidb The Microbial Protein Interaction Database busiek-2012-1 The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Busiek K.K., Eraso J.M., Wang Y., Margolin W. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation busiek-2012-2 The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Busiek K.K., Eraso J.M., Wang Y., Margolin W. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation busiek-2012-3 The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. ecolx Escherichia coli anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Busiek K.K., Eraso J.M., Wang Y., Margolin W. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation busiek-2012-4 The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Busiek K.K., Eraso J.M., Wang Y., Margolin W. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG ftsa-ftsn-3 1339588 not-defined-1542242960 1339592 unspecified role unspecified role bait bait region glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1121562599 1339593 unspecified role unspecified role prey prey region P29131-1-55 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false p29131-- P29131-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3 ftsa-ftsn-2 1339588 not-defined-770596964 1339593 unspecified role unspecified role prey prey region P29131-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-2008549443 1339592 unspecified role unspecified role bait bait p0abh0-- P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 1B ftsn-ftsa-2 1339589 not-defined-831114275 1339593 unspecified role unspecified role bait bait p29131-1-128 P29131-1-128 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-444339295 1339592 unspecified role unspecified role prey prey physical association physical association false false false figure 2 ftsn-ftsa-1 1339590 not-defined-778213886 1339593 unspecified role unspecified role bait bait not-defined-172101621 1339592 unspecified role unspecified role prey prey p0abh0-- P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region P0ABH0-80-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false p0abh0-- P0ABH0-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5 ftsn-ftsa-3 1339591 not-defined-1712572431 1339593 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal P29131-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region P29131-1-33 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1384372350 1339592 unspecified role unspecified role prey prey p0abh0-- P0ABH0-- glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false figure 4 The cytoplasmic domain of FtsN (1-33) is necessary and sufficient for interaction with FtsA, but only if the cytoplasmic domain is in a parallel homodimer.