IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tavares-2012-1 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-6 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-2 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-4 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-5 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-7 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-fibroblast Mus musculus fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation tavares-2012-3 RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. mouse-neuronal_precursor_cells(stem cells) Mouse Neuronal precursor cells/neural stem progenitor cells neuronal_precursor (stem cells) Neuronal Precursor Cells/neural stem progenitor cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Cell (0092-8674) 2012 Only protein-protein interactions imex curation cdx2_mouse_gene Homeobox protein CDX-2 gene gene gene mouse Mus musculus Mouse ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK hxa7_mouse_gene Homeobox protein Hox-A7 gene gene mouse Mus musculus Mouse msx1_mouse_gene Homeobox protein MSX-1 gene gene mouse Mus musculus Mouse gata4_mouse_gene Mouse gata4 gene gene gene mouse Mus musculus Mouse nkx22_mouse_gene Homeobox protein Nkx-2.2 gene gene mouse Mus musculus Mouse atoh1_mouse_gene Protein atonal homolog 1 gene gene mouse Mus musculus Mouse pax3_mouse_gene Paired box protein Pax-3 gene gene mouse Mus musculus Mouse sox1_mouse_gene gene gene mouse Mus musculus Mouse Not currently in Ensembl (03/12) pcgf2_mouse Polycomb group RING finger protein 2 Pcgf2 Mel18 Mel-18 Rnf110 Zfp144 Znf144 DNA-binding protein Mel-18 Melanoma nuclear protein 18 RING finger protein 110 Zinc finger protein 144 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP rybp_mouse RING1 and YY1-binding protein Rybp Dedaf Death effector domain-associated factor protein protein mouse Mus musculus Mouse MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF cbx7_mouse Chromobox protein homolog 7 Cbx7 D15Ertd417e protein protein mouse Mus musculus Mouse MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL phc1_mouse Polyhomeotic-like protein 1 Phc1 Edr Edr1 Rae28 Early development regulatory protein 1 RAE-28 protein protein mouse Mus musculus Mouse METESEQNSSSTNGSSSSGASSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNSSTAQQQTATTQASMNLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPPAQSPGVHADADQVQNLAVRNQQASAQGPQMPGSTQKAIPPGASPVSGLSQTSSQALAVAQASSGASGQSLNLSQAGGGSGNSLPGSMGPGGGGQAPGGLGQLPSSGLTGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQSVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQQQQQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLTLPPEPTSKPPIPIQSKPPVAPIKPPQLGAAKMSATQQPPPHIPVQVVGTRQPGSAQAQALGLAQLAAAVPTPRGITGAVQPGQAHLASSPPSSQAAPGALQECPPALAAGMTLAPVQGTAHVVKGGPTASSPVVAQVPAAFYMQSVHLPGKAQTLAVKRKAESEEERDDLSALASVLPTKASPAAESPKVIEEKNSLGEKAEPVASLNANPPNSDLVALAPTPSAPPPTLALVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQFLKETEKPLQAGLPTGLNESQPSGPLGGDSPSVELEKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNTITTPSTPELQGINPVFLSSNPSQWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET cbx8_mouse Chromobox protein homolog 8 Cbx8 Pc3 Polycomb 3 homolog protein protein mouse Mus musculus Mouse MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSTRGIRIPYPGRSPQDLASTSRAREGLRNTGLPPPGSSTSTCRADPPRDRDRERDRGTSRVDDKPSSPGDSSKKRGPKPRKEPLDPSQRPLGEPSAGLGEYLKGRKLDETSSGTGKFPAGHSVIQLARRQDSDLVQYGVTSPSSAEASSKLAVDTFPARVIKHRAAFLEAKGQGALDPGGARVRHSSGTPASVGSLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR phc3_mouse Polyhomeotic-like protein 3 Phc3 protein protein mouse Mus musculus Mouse MDSEPSSGTSVSTTASSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYAAQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSILSASPAPAQLMNRSQTSSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSPSPSCQSAAAQVQNLTLRSQKLGVLSSSQNGSPKSAGQTQSLTICHNKTTVTSSKISQRDPSPESKKGGSPGLESRSTAVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPPKVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNHGLSPAPSNAQPQHCSPVQSHPPPLTVSPNQAQSAQQSVVVSPPPPHSPSQSPTIIIHPQALIQPHPLVSSALQTGPNLQQAAADQVQSTAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQMVSPTSHQQYSALQSSPIPIATPPQMSASPPAQLPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQTLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECARMDRTPPPPTLSPAAVTVGRGEDLTSEHPLLEQVELPAVASVSASVIKSPSDPTHASAPAPPLLIPAASTRSSSTSLASSTPSLENKPPQAIVKPQILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVVNSVCVQPELQNNTKHADNSSDTEIEDMMAEETLEEMDSELLKCEFCGKMGYPNEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRRPSGPEGAAREHILRQLPITYPSAEEDVASHEDPVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLPVAQTEPSIWTVDDVWAFIHSLPGCQDVADEFRAQEIDGQALLLLKEDHLMSAMNMKLGPALKICARINSLKDS ring1_mouse E3 ubiquitin-protein ligase RING1 Ring1 Ring1A Rnf1 RING finger protein 1 Polycomb complex protein RING1 Transcription repressor Ring1A RING-type E3 ubiquitin transferase RING1 protein protein mouse Mus musculus Mouse MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS cbx2_mouse Chromobox protein homolog 2 Cbx2 M33 Modifier 3 protein protein protein mouse Mus musculus Mouse MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVTSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDLKVRTQKGGELGGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEKLTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPSAAQNLSVAIQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY pcgf1_mouse Polycomb group RING finger protein 1 Pcgf1 Nspc1 Rnf68 RING finger protein 68 Nervous system Polycomb-1 protein protein mouse Mus musculus Mouse MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR pcgf6_mouse Polycomb group RING finger protein 6 Pcgf6 Mblr Rnf134 RING finger protein 134 Mel18 and Bmi1-like RING finger protein protein mouse Mus musculus Mouse MDEAETDATENKRASEAKRASAMPPPPPPPPPISPPALIPAPAAGEEGPASLGQAGAAGCSRSRPPALEPERSLGRLRGRFEDYDEELEEEEEMEEEEEEEEEMSHFSLRLESGRADSEDEEERLINLVELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAAPQPVPSSKGKTKKVLESVFRIPPELDMSLLLEFIGANEDTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLERYQTLREIRRAIGDTAMQDGLLVLHYGLVVSPLKIT cbx4_mouse E3 SUMO-protein ligase CBX4 Cbx4 Pc2 Chromobox protein homolog 4 Polycomb 2 homolog E3 SUMO-protein transferase CBX4 protein protein mouse Mus musculus Mouse MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKGQGHQYELNSKKHHQYQPHSKERSGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGTKSHPPDKWAHGAAAKGYLGAVKPLGGGAGAPGKGSEKGPPNGMTPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEAAEGEARSPSHKKRAAEERHPQGDRTFKKAAGASEEKKAEVPCKRREEEALVSGDAQPQDLGSRKLSPTKEAFGEQPLQLTTKPDLLAWDPARSSHPPAHHHHHHHHHHHHHTVGLNLSHARKRCLSETHGEREPCKKRLTARSISTPTCLGGSPVSEHPANVSPTAASLPQPEVILLDSDLDEPIDLRCVKMRSDAGEPPSTLQVKPEAPAVAAVVAPAPASEKPPAEAQEEPVEPLSEFKPFFGNIIITDVTANCLTVTFKEYVTV rnf2-cdx2 1281640 n/a 1281647 acceptor acceptor prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 and reduced occupancy of RING1B on this gene. rnf2-hxa7 1281640 n/a 1281649 unspecified role unspecified role prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-msx1 1281640 n/a 1281648 acceptor acceptor bait bait n/a 1281650 unspecified role unspecified role prey prey association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-gata4 1281640 n/a 1281648 acceptor acceptor bait bait n/a 1281651 unspecified role unspecified role prey prey association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-nkx22 1281640 n/a 1281652 unspecified role unspecified role prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-atoh1 1281640 n/a 1281653 unspecified role unspecified role prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-pax3 1281640 n/a 1281654 unspecified role unspecified role prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-sox1 1281640 n/a 1281655 unspecified role unspecified role prey prey n/a 1281648 acceptor acceptor bait bait association association false false false Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. pcgf2-cdx2 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281647 unspecified role unspecified role prey prey association association false false false Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-hxa7-1 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281649 unspecified role unspecified role prey prey association association false false false Supp. Fig.3B Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-msx1-1 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281650 unspecified role unspecified role prey prey association association false false false Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-gata4-1 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281651 unspecified role unspecified role prey prey association association false false false Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-nkx22-1 1281640 n/a 1281652 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role bait bait association association false false false Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-atoh1-1 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281653 unspecified role unspecified role prey prey association association false false false Fig. 1A Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-pax3-1 1281640 n/a 1281654 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role bait bait association association false false false Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-sox1-1 1281640 n/a 1281656 unspecified role unspecified role bait bait n/a 1281655 unspecified role unspecified role prey prey association association false false false Fig. 1A Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-cdx2 1281640 n/a 1281657 unspecified role unspecified role bait bait n/a 1281647 unspecified role unspecified role prey prey association association false false false Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-hxa7 1281640 n/a 1281649 unspecified role unspecified role prey prey n/a 1281657 unspecified role unspecified role bait bait association association false false false Supp. Fig.3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-msx1 1281640 n/a 1281650 unspecified role unspecified role prey prey n/a 1281657 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-gata4-1 1281640 n/a 1281651 acceptor acceptor prey prey n/a 1281657 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-nkx22-1 1281640 n/a 1281657 unspecified role unspecified role bait bait n/a 1281652 unspecified role unspecified role prey prey association association false false false Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-pax3 1281640 n/a 1281654 unspecified role unspecified role prey prey n/a 1281657 unspecified role unspecified role bait bait association association false false false Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-sox1-1 1281640 n/a 1281657 unspecified role unspecified role bait bait n/a 1281655 acceptor acceptor prey prey association association false false false Supp Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment rybp-cdx2 1281640 n/a 1281647 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-hxa7 1281640 n/a 1281658 unspecified role unspecified role bait bait n/a 1281649 unspecified role unspecified role prey prey association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-msx1 1281640 n/a 1281650 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-b2mg-1 1281640 n/a 1281651 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-nkx22 1281640 n/a 1281658 unspecified role unspecified role bait bait n/a 1281652 unspecified role unspecified role prey prey association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-atoh1 1281640 n/a 1281653 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-pax3 1281640 n/a 1281654 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-sox1 1281640 n/a 1281658 unspecified role unspecified role bait bait n/a 1281655 unspecified role unspecified role prey prey association association false false false Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-pcgf2 1281641 n/a 1281658 unspecified role unspecified role bait bait n/a 1281656 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey association association false false false Fig. 5A, Supp. Fig. 5A cbx7-pcgf2-8 1281641 n/a 1281659 unspecified role unspecified role bait bait n/a 1281656 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey n/a 1281660 unspecified role unspecified role prey prey association association false false false Fig. 5A, Supp Fig. 5A rnf2-cbx7 1281641 n/a 1281660 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role bait bait n/a 1281656 unspecified role unspecified role prey prey n/a 1281659 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role prey prey association association false false false Fig. 5A, Supp Fig. 5A Interaction occurs in EED +/+ and -/- cells. pcgf2-cbx7-2 1281641 n/a 1281656 unspecified role unspecified role bait bait n/a 1281659 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey association association false false false Fig. 5A, Supp. Fig. 5A Interactions were observed in EED +/+ and -/- cells. pcgf2-cbx2 1281642 n/a 1281661 unspecified role unspecified role prey prey n/a 1281659 unspecified role unspecified role prey prey n/a 1281660 unspecified role unspecified role prey prey n/a 1281662 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey n/a 1281663 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role prey prey n/a 1281664 unspecified role unspecified role prey prey n/a 1281665 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4B, Supp. Fig. 4A rybp-pcgf1 1281642 n/a 1281666 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281656 unspecified role unspecified role prey prey n/a 1281663 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey n/a 1281667 unspecified role unspecified role prey prey association association false false false Fig. 4B cbx7-pcgf2-4 1281642 n/a 1281660 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role prey prey n/a 1281659 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281648 unspecified role unspecified role prey prey association association false false false Fig. 4B pcgf2-cbx2-3 1281643 n/a 1281658 unspecified role unspecified role prey prey n/a 1281659 unspecified role unspecified role prey prey n/a 1281660 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4C, Supp.Fig. 4B rybp-pcgf1-1 1281643 n/a 1281658 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281656 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey association association false false false Fig. 4C cbx7-pcgf2-3 1281643 n/a 1281659 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281648 unspecified role unspecified role prey prey n/a 1281667 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role prey prey association association false false false Fig. 4B cbx7-pcgf2-7 1281644 n/a 1281659 unspecified role unspecified role neutral component neutral component n/a 1281648 unspecified role unspecified role neutral component neutral component n/a 1281656 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281658 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supp. Fig. 4C cbx7-rnf2-2 1281644 n/a 1281658 unspecified role unspecified role neutral component neutral component n/a 1281648 unspecified role unspecified role neutral component neutral component n/a 1281659 unspecified role unspecified role neutral component neutral component physical association physical association false false false Supp Fig. 4D Complex present in both Polycomb protein EED +/+ and -/- cells. rnf2-cbx7-1 1281645 n/a 1281659 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role bait bait n/a 1281658 unspecified role unspecified role prey prey association association false false false Supp Fig. 5B Interaction occurs in EED +/+ and -/- cells. rnf2-cbx7-2 1281645 n/a 1281656 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role bait bait n/a 1281648 unspecified role unspecified role prey prey association association false false false Supp Fig. 5B Interaction occurs in EED +/+ and -/- cells. pcgf2-cbx2-2 1281646 n/a 1281668 unspecified role unspecified role prey prey n/a 1281663 unspecified role unspecified role prey prey n/a 1281664 unspecified role unspecified role prey prey n/a 1281658 unspecified role unspecified role prey prey n/a 1281648 unspecified role unspecified role prey prey n/a 1281662 unspecified role unspecified role prey prey n/a 1281660 unspecified role unspecified role prey prey n/a 1281656 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1281661 unspecified role unspecified role prey prey n/a 1281665 unspecified role unspecified role prey prey association association false false false Supp. Fig. 4B