MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint singh-2012a-2 Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Singh S., Ashish null., Dikshit KL. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation singh-2012a-1 Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Singh S., Ashish null., Dikshit KL. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation sak_staan Staphylokinase sak SA1758 protein protein staan Staphylococcus aureus (strain N315) MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK mint plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN plg-sak-3 1254628 staphylokinase SAK 1254630 predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified plmn_human Pg 1254631 predetermined featur predetermined feature enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction false false false 1254628 mint t1 f2a f2b plg-sak-4 1254628 staphylokinase SAK 1254630 predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Pro69Leu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined featur predetermined feature enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction false false false 1254628 mint t1 f2a f2b plg-sak-5 1254628 staphylokinase SAK 1254630 predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Val72Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined featur predetermined feature enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction false false false 1254628 mint t1 f2a f2b plg-sak-6 1254628 staphylokinase SAK 1254630 predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Tyr71Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q99SU7:p.Val72Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction false false false 1254628 mint t1 f2a f2b plg-sak 1254629 staphylokinase SAK 1254630 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Pro69Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1254629 mint t2 sf1 sf2 plg-sak-1 1254629 staphylokinase SAK 1254630 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Val72Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1254629 mint t2 sf1 sf2 plg-sak-2 1254629 staphylokinase SAK 1254630 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Val72Tyr mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false plmn_human Pg 1254631 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1254629 mint t2 sf2