Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com pandey-2012-2 The Caenorhabditis elegans D2-like dopamine receptor DOP-2 physically interacts with GPA-14, a G-alpha-i subunit. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pandey P., Harbinder S. Bait construct :-Dp-2c was fused to- C-terminal part of ubiquitin (Cub) followed by LexA-VP16 transcription factor. Prey constructs:- library molecules were C terminally tagged with N terminal Ubiquitin (I13G)(NubG). hsdhillon@desu.edu, pratimasharmash@yahoo.com adult C. elegans cDNA J Mol Signal 2012 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. pandey-2012-1 The Caenorhabditis elegans D2-like dopamine receptor DOP-2 physically interacts with GPA-14, a G-alpha-i subunit. yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pandey P., Harbinder S. Bait construct :-Dp-2c was fused to- C-terminal part of ubiquitin (Cub) followed by LexA-VP16 transcription factor. Prey constructs:- library molecules were C terminally tagged with N terminal Ubiquitin (I13G)(NubG). hsdhillon@desu.edu, pratimasharmash@yahoo.com adult C. elegans cDNA J Mol Signal 2012 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. pandey-2012-3 The Caenorhabditis elegans D2-like dopamine receptor DOP-2 physically interacts with GPA-14, a G-alpha-i subunit. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pandey P., Harbinder S. Bait construct :-Dp-2c was fused to- C-terminal part of ubiquitin (Cub) followed by LexA-VP16 transcription factor. Prey constructs:- library molecules were C terminally tagged with N terminal Ubiquitin (I13G)(NubG). hsdhillon@desu.edu, pratimasharmash@yahoo.com adult C. elegans cDNA J Mol Signal 2012 Only protein-protein interactions imex curation Molecular Connections Pvt. Ltd. gpa14_caeel Guanine nucleotide-binding protein alpha-14 subunit gpa-14 B0207.3 protein protein caeel Caenorhabditis elegans MAFSCFDKFSYTYCYQCMHGPDGCMVPSRNGEGTELYAHSEELEAKLRELARRGHMEIEKELALEKKTYGSHIKILILGGPLSGKSTIFKQMQIIHVDGFKTDQELIQYRGLIDNNIRDIYLQLIAGSRVVGIPLDPIEHITYEIDEIYAPMSDAFSVRTISELLEPLTEFWNSKQIQEIYKRRCEFELLDSTKYYLENLTRIADPTYLPNQEDIVHSRKATMSINSIVFEYTGVSLLMIDVGGQRSERKKWLHLFDDAKVVLFVIDLTGYAKRSEESRMELSRFPKFFRDVGSNAYDMKVALKIFNEVAAASALANAVFLLFFNKVDLFKEILSQVNLQPCFSKFDGENTYEETSKYICEKFIRAASSKKSVFPHFTTATNTENVKLVFRACMESVFKANAKATGLS dopr2_caeel Dopamine receptor 2 Dopamine D2-like receptor dop-2 dop-2 K09G1.4 dop-2L protein protein caeel Caenorhabditis elegans MEAGETWNVSLEWPPPSLDLSTITQTPSTIVGSGIPLNYAGLSLIVIPLITLLGNLLVIISVLRYRALQSAINFLILGLAVADLLVAIIVMPYAVYVYVTNGDWYLGNLMCDIYMASDVCCSTASILLLAVISFDRYRAVSLPIQYSRQSQNVKRVWTLIAVIWLVSLTLASPMVFGVNVRPPDANPYECRFYNAEFSILSSMISFVIPCFLVLFVYIRIIIALKKREKAAKMRREKNTIAHGLTMRPDTGEEQVDEEAAGRIVAGPVVNVMMAALPSMTRRMRQFERHRRAIELAGDEEWEEDELDVMDECCGGDDAGDDDDDYHADNGQGVVEASAPRTTSMLRRIINAASVGTANSTAQSVASASGMPAFFAQNISTTSPSSSSCARTTTTTSAIPKASGDLPLPMLLNEREFGNSSTPRSSLESLSENVNVITNDFVSENCTTFSRRSSYADDSQPTSSQTSSGDGRSYSIKGQKRFRNLSRNYSTKHHRKVVKVNRGNSRNNSRTASITNQSDDALIPAIIRTISRKSPRLFRRDKTDIKKHSMILANPITEPPKEYRRVSMPIHPTNSQTETETISASRDIENLPTTTISRSTTANSAELLGSPDDFEKFPALITETVLEDVLAETREGCFMQPTVSFALTVREMEGNALNNLKGCSVESSRRVSQVDPPLAIQILTRPSLPHLDLQRMDSIGTTCSSKTRADSLRSVDSKGSKKSNRNGIAVKLVKRAIKHEHSLKRKVSKAQRKEKRATKTLGVVVGVFLVCWVPFFVINILNAVCILLNKDSCQVGYDLFFYCTWIGYMNSFMNPIIYTIFNTEFRRAFKSIIFGRNSTRHHFSNKQAHV dop_2-gpa_14-1 1272867 n/a 1272870 unspecified role unspecified role bait bait n-term gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1272871 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated in vitro In vitro direct interaction direct interaction false false false fig. 2b dop_2-gpa_14-2 1272867 n/a 1272871 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated intracellular loop 3 and c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 1272870 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro direct interaction direct interaction false false false fig. 4c dop_2-gpa_14 1272868 n/a 1272871 unspecified role unspecified role bait bait cub_lexa-vp16_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1272870 unspecified role unspecified role prey prey nubg_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig. 2a gpa_14-dop_2 1272869 n/a 1272871 unspecified role unspecified role bait bait intracellular loop 3 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1272870 unspecified role unspecified role prey prey physical association physical association false false false fig. 4b