MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2011s-1 Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li S., Duan J., Li D., Ma S., Ye K. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation li-2011s-2 Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Li S., Duan J., Li D., Ma S., Ye K. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation li-2011s-4 in vitro In vitro crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Li S., Duan J., Li D., Ma S., Ye K. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation li-2011s-3 Structure of the Shq1-Cbf5-Nop10-Gar1 complex and implications for H/ACA RNP biogenesis and dyskeratosis congenita. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li S., Duan J., Li D., Ma S., Ye K. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation cbf5_yeast H/ACA ribonucleoprotein complex subunit CBF5 Small nucleolar RNP protein CBF5 L9470.11 YLR175W CBF5 Centromere/microtubule-binding protein CBF5 Centromere-binding factor 5 H/ACA snoRNP protein CBF5 p64' protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKEDFVIKPEAAGASTDTSEWPLLLKNFDKLLVRSGHYTPIPAGSSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYESNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGALSENDNMVTLHDVMDAQWVYDNTRDESYLRSIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELYDEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNENTPEQWKKEYVPLDNAEQSTSSSQETKETEEEPKKAKEDSLIKEVETEKEEVKEDDSKKEKKEKKDKKEKKEKKEKKDKKEKKEKKEKKRKSEDGDSEEKKSKKSKK D356B39FDCC32E2D nop10_yeast H/ACA ribonucleoprotein complex subunit NOP10 YHR072W-A Nucleolar protein family A member 3 snoRNP protein NOP10 NOP10 Nucleolar protein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 4718D35AF7911FBA shq1_yeast Protein SHQ1 Small nucleolar RNAs of the box H/ACA family quantitative accumulation protein 1 YIL104C SHQ1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MITPRFSITQDEEFIFLKIFISNIRFSAVGLEIIIQENMIIFHLSPYYLRLRFPHELIDDERSTAQYDSKDECINVKVAKLNKNEYFEDLDLPTKLLARQGDLAGADALTENTDAKKTQKPLIQEVETDGVSNNIKDDVKTIGQMGEGFNWEIEQKMDSSTNNGILKTKYGFDNLYDTVISVSTSNGNDINELDDPEHTDANDRVIERLRKENLKFDPEYYVSEYMTHKYGNEEDLEINGIKELLKFTPSIVKQYLQWYKDSTNPNLVMPIEFTDEEQKQMQDNLPKKSYLVEDIKPLYVTILSVLFSYVFEQIENEGTHTTESAWTMGKLCPQISFLDQQLKQVNELQDGMKEISKVNKDSSLIKIAIITGIRRALSYPLHRNYDLAMKAWTFVYYILRGGKRLVIRALLDIHETFRFHDVYYVYDKVLLDDLTAWFISQGSENVIRSLALEMRKEQESLSKQDIEFECIASFNEQTGEPEWETLNIREMEILAESEYREQQQNPQ 15A6A66C66E70C39 gar1_yeast H/ACA ribonucleoprotein complex subunit GAR1 YHR089C GAR1 snoRNP protein GAR1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRGGNRGGRGGFRGGFRGGRTGSARSFQQGPPDTVLEMGAFLHPCEGDIVCRSINTKIPYFNAPIYLENKTQVGKVDEILGPLNEVFFTIKCGDGVQATSFKEGDKFYIAADKLLPIERFLPKPKVVGPPKPKNKKKRSGAPGGRGGASMGRGGSRGGFRGGRGGSSFRGGRGGSSFRGGSRGGSFRGGSRGGSRGGFRGGRR C197FE85644DD0F8 nhp2_yeast H/ACA ribonucleoprotein complex subunit NHP2 NHP2 YDL208W D1045 H/ACA snoRNP protein NHP2 High mobility group-like nuclear protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKDNKEHKESKESKTVDNYEARMPAVLPFAKPLASKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGATKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL 008188132B494E5D naf1_yeast H/ACA ribonucleoprotein complex non-core subunit NAF1 YNL124W N1888 NAF1 Nuclear assembly factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDDLFSKALENPDQDLNVELPKDDVDLGLLGDGGNERKTDEPVADAERSTGLGSGSSESESDSGSDSDSDSGSSGSEDDSADQDVEGEDEGGDAIENEDEDEDPSPSGPILSKNEILEETVPELPEDYEISEKTIITPIGVLKSAFENNIIIHATMSGEKRVLKEGSIFCLEDRTLIGMLTEVFGPLQNPFYRIKLPDSKKNLFDELKVRLGEKAFIVTPDAHWIDTFELKRNKGTDASNGYDEELPEEEQEFSDDEKEALFKKMKKQQRQRKKRDNRKLANDSDNVKVKRARQPKANSLPKLVPPLGMSSNAPMQHGYKSRNARENIKRESSATSNRNGSSPVPITQHHQQQFSANNYPFPQQPNGMPYPPYSPFPQPTNFQYPPPPFGQATPAQFSNTVPYGSLPPAYNNMSPPTQQSFMPMTQSQPPLPYGVPPMNQMQNPMYIQPPPQAPPQGNGNFQQVMELHQILLQQQQQQHQYQHQHQQDPRT 5A496278070F6255 cbf5-nop10 1266280 cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1a homomint mint cbf5-gar1-1 1266280 shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gar1_yeast GAR1 1266287 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false association association false false false f1a homomint mint cbf5-gar1-2 1266280 gar1_yeast GAR1 1266287 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nhp2_yeast NHP2 1266288 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1a f1b homomint mint cbf5-nhp2-3 1266280 cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nhp2_yeast NHP2 1266288 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1a homomint mint cbf5-naf1-1 1266280 cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified naf1_yeast NAF1 1266289 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nhp2_yeast NHP2 1266288 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified physical association physical association false false false f1a homomint mint cbf5-naf1-2 1266280 cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false naf1_yeast NAF1 1266289 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1a homomint mint cbf5-gar1-3 1266280 shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gar1_yeast GAR1 1266287 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nhp2_yeast NHP2 1266288 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1b homomint mint cbf5-gar1-4 1266280 nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified gar1_yeast GAR1 1266287 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nhp2_yeast NHP2 1266288 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1b homomint mint cbf5-gar1-5 1266280 gar1_yeast GAR1 1266287 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false shq1_yeast SHQ1 1266286 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified nop10_yeast NOP10 1266285 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified association association false false false f1b homomint mint cbf5-nop10-1 1266281 cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false 1266281 homomint mint f1c st1 cbf5-gar1-6 1266281 shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gar1_yeast GAR1 1266287 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false 1266281 homomint mint f1c st1 cbf5-gar1-7 1266281 shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gar1_yeast GAR1 1266287 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false 1266281 homomint mint f1c st1 cbf5-gar1-8 1266281 nhp2_yeast NHP2 1266288 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gar1_yeast GAR1 1266287 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1266281 homomint mint f1c st1 cbf5-nop10-2 1266281 shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P40486:p.Trp326Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false 1266281 homomint mint f4f st1 cbf5-nop10-3 1266281 nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P40486:p.Glu219Lys mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1266281 homomint mint f4f st1 cbf5-nop10-4 1266281 cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P40486:p.Asp421Lys mutation increasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1266281 homomint mint f4f st1 cbf5-nop10-5 1266281 shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P40486:p.Arg383Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false 1266281 homomint mint f4f st1 cbf5-gar1-12 1266282 N/A SHQ1 1266288 unspecified role unspecified role neutral component neutral component purified purified lys-65 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys-61 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys-69 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A GAR1 1266287 unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A CBF5 1266284 unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A NOP10 1266285 unspecified role unspecified role neutral component neutral component purified purified lys-40 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys-40 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys-40 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 1266421 1266414 1266422 1266413 1266423 1266415 physical association physical association false false false homomint mint f7 cbf5-gar1-9 1266283 shq1_yeast SHQ1 1266286 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gar1_yeast GAR1 1266287 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cbf5_yeast CBF5 1266284 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nop10_yeast NOP10 1266285 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false homomint mint t1 f3 f4 f6b sf1 sf3