MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint williams-2012-3 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation williams-2012-1 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation williams-2012-2 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation williams-2012-4 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation williams-2012-5 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation williams-2012-6 Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation pex22_yeast Peroxisome assembly protein 22 YAL055W PEX22 Peroxin-22 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN ubcx_yeast Ubiquitin-conjugating enzyme E2-21 kDa PEX4 PAS2 UBC10 Ubiquitin-protein ligase Ubiquitin carrier protein Peroxin-4 YGR133W E2 ubiquitin-conjugating enzyme PEX4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH pex22-pex4-4 1284733 pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1284733 mint t1 sf1 pex22-pex4-5 1284733 pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Phe mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1284733 mint t1 sf1 pex22-pex4-6 1284733 ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P39718:p.Lys133Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1284733 mint t1 sf1 pex22-pex4-2 1284734 pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f3 t2 f5 pex22-pex4-3 1284735 ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false st1 mint pex22-pex4-7 1284736 pex22_yeast PEX22 1284739 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubcx_yeast PEX4 1284740 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint sf5 st2 pex4-pex22-1 1284737 ubcx_yeast PEX4 1284740 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false pex22_yeast PEX22 1284739 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f7b mint pex22-pex4-8 1284738 ubcx_yeast PEX4 1284740 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pex22_yeast PEX22 1284739 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f6a mint