mpidb The Microbial Protein Interaction Database liu-2011l-1 Homodimerization and binding of specific domains to the target DNA are essential requirements for HlyU to regulate expression of the virulence gene rtxA1, encoding the repeat-in-toxin protein in the human pathogen Vibrio vulnificus. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Liu M., Rose M., Crosa J.H. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation liu-2011l-2 Homodimerization and binding of specific domains to the target DNA are essential requirements for HlyU to regulate expression of the virulence gene rtxA1, encoding the repeat-in-toxin protein in the human pathogen Vibrio vulnificus. vibvl Vibrio vulnificus bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu M., Rose M., Crosa J.H. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation a0a3q0l222_vibvu VV1_0512 protein protein vibvu vibvu MNLKDMEQNSAKAVVLLKAMANERRLQILCMLHNQELSVGELCAKLQLSQSALSQHLAWLRRDGLVTTRKEAQTVYYTLKSEEVKAMIKLLHSLYCEE q8des3-q8des3 1339309 not-defined-1604521262 1339311 unspecified role unspecified role prey prey A0A3Q0L222:p.[Leu17Ala;Leu91Ala] Q8DES3-17-91 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region Q8DES3-2-20 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false A0A3Q0L222:p.Leu91Ala Q8DES3-91-91 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false A0A3Q0L222:p.Leu17Ala Q8DES3-17-17 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false not-defined-708731129 1339311 unspecified role unspecified role bait bait region Q8DES3-2-20 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false A0A3Q0L222:p.Leu91Ala Q8DES3-91-91 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false A0A3Q0L222:p.Leu17Ala Q8DES3-17-17 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false A0A3Q0L222:p.[Leu17Ala;Leu91Ala] Q8DES3-17-91 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4 q8des3-q8des3-1 1339310 not-defined-708731129 1339311 unspecified role unspecified role neutral component neutral component A0A3Q0L222:p.[Leu17Ala;Leu91Ala] Q8DES3-17-91 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false figure 4