UniProt UniProt http://www.uniprot.org wang-2011e-5 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/C(CDH1). in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Wang L.Y., Kung H.J. Cancer - Interactions investigated in the context of cancer hkung@ucdavis.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation wang-2011e-1 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/C(CDH1). human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang L.Y., Kung H.J. Cancer - Interactions investigated in the context of cancer hkung@ucdavis.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation wang-2011e-2 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/C(CDH1). human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L.Y., Kung H.J. Cancer - Interactions investigated in the context of cancer hkung@ucdavis.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation wang-2011e-3 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/C(CDH1). human-cwr22rv1 Homo sapiens cwr22rv1 Androgen-responsive human prostate carcinoma cell line CWR22Rv1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L.Y., Kung H.J. Cancer - Interactions investigated in the context of cancer hkung@ucdavis.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation wang-2011e-4 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/C(CDH1). human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L.Y., Kung H.J. Cancer - Interactions investigated in the context of cancer hkung@ucdavis.edu Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation mak_human Serine/threonine-protein kinase MAK MAK Male germ cell-associated kinase protein protein human Homo sapiens Human MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESKQSLNKQLQPLESKPSLVEVEPKPLPDIIDQVVGQPQPKTSQQPLQPIQPPQNLSVQQPPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRLPEPVPSGSNHSTGENKSLPAVTSLKSDSELSTAPTSKQYYLKQSRYLPGVNPKKVSLIASGKEINPHTWSNQLFPKSLGPVGAELAFKRSNAGNLGSYATYNQSGYIPSFLKKEVQSAGQRIHLAPLNATASEYTWNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR cdk20_human Cyclin-dependent kinase 20 CDK20 CCRK CDCH CDK-activating kinase p42 Cell cycle-related kinase Cell division protein kinase 20 Cyclin-dependent protein kinase H Cyclin-kinase-activating kinase p42 protein protein human Homo sapiens Human MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG fzr1-mak 1293086 n/a 1293091 enzyme enzyme unspecified role unspecified role v5-mak v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1293092 enzyme target enzyme target substrate substrate unspecified role unspecified role gst-fzr1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 5a fzr1-mak-1 1293086 n/a 1293092 enzyme target enzyme target substrate substrate unspecified role unspecified role gst-fzr1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1293091 enzyme enzyme unspecified role unspecified role v5-mak v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation false false false Figure 5b MAK phosphorylates CDH1 during G2 to M phase. fzr1-mak-2 1293086 n/a 1293091 enzyme enzyme unspecified role unspecified role gst-mak gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1293092 enzyme target enzyme target substrate substrate unspecified role unspecified role gst-fzr1 gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 5c Mutant CDH1(4A) lacks the four major phosphoacceptor sites of CDK (S40A, T121A, S151A, S163A) and mutant CDH1(9A) lacks all nine acceptor sites (T32, S36, S40, S70, T121, S138, S146, S151, S163). Phosphorylation of CDH1(4A) by MAK was significantly diminished, and only marginal phosphorylation of CDH1(9A) could be detected mak-cdk20 1293087 n/a 1293091 unspecified role unspecified role bait bait flag-mak flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1293093 unspecified role unspecified role prey prey ha-cdk20 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 3D mak-fzr1 1293087 n/a 1293092 unspecified role unspecified role prey prey ha-fzr1 ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1293091 unspecified role unspecified role bait bait v5-mak v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 4A mak-fzr1-2 1293088 n/a 1293091 unspecified role unspecified role bait bait n/a 1293092 unspecified role unspecified role prey prey physical association physical association false false false Figure 4B mak-fzr1-3 1293089 n/a 1293092 unspecified role unspecified role prey prey n/a 1293091 unspecified role unspecified role bait bait physical association physical association false false false Fig 4B mak-fzr1-4 1293090 n/a 1293091 unspecified role unspecified role bait bait n/a 1293092 unspecified role unspecified role prey prey physical association physical association false false false Fig 4B