mpidb The Microbial Protein Interaction Database ollis-2011-1 The same periplasmic ExbD residues mediate in vivo interactions between ExbD homodimers and ExbD-TonB heterodimers. ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Ollis A.A., Postle K. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK tonb_ecoli Protein TonB tonB exbA JW5195 b1252 protein protein ecoli Escherichia coli (strain K12) MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ exbb_ecoli Biopolymer transport protein ExbB JW2974 b3006 exbB protein protein ecoli Escherichia coli (strain K12) MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQKLRAG exbd-exbd 1339255 not-defined-1523179338 1339256 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Val110Cys P0ABV2-110-110 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Lys98Cys P0ABV2-98-98 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp111Cys P0ABV2-111-111 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp99Cys P0ABV2-99-99 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp120Cys P0ABV2-120-120 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Gly96Cys P0ABV2-96-96 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Ile102Cys P0ABV2-102-102 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Thr109Cys P0ABV2-109-109 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Lys108Cys P0ABV2-108-108 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp107Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Glu95Cys P0ABV2-95-95 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Ala92Cys P0ABV2-92-92 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 3, 4 Oxidizing agent CuoP After treatment with oxidising agent, only 3 substitutions, K97C, T114C, and K117C, still showed no homodimer formation. For E95C, G96C, D99C, and I102C, homodimer levels remained unchanged after CuoP treatment. Significant increases in homodimers were observed for T109C - E113C, L115C, and M116C. exbd-p02929 1339255 not-defined-26182058 1339256 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Lys108Cys P0ABV2-108-108 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Ile102Cys P0ABV2-102-102 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp120Cys P0ABV2-120-120 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Val110Cys P0ABV2-110-110 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp107Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp111Cys P0ABV2-111-111 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Ala92Cys P0ABV2-92-92 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Gly96Cys P0ABV2-96-96 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Thr109Cys P0ABV2-109-109 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 not-defined-1862108060 1339257 unspecified role unspecified role unspecified role unspecified role region P02929-18-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 6 exbb-exbd 1339255 not-defined-2010997993 1339258 unspecified role unspecified role unspecified role unspecified role not-defined-993581741 1339256 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp25Asn P0ABV2-25-25 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Lys108Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4