InnateDB InnateDB chuang-2011-3 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. human-j-tag Homo sapiens T cell j-tag Human T cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-10 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-1 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-5 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-9 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-2 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-4 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-6 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-7 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. chuang-2011-8 The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. kpct_human Protein kinase C theta type PRKCQ nPKC-theta PRKCT protein protein human Homo sapiens Human MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS m4k3_human Mitogen-activated protein kinase kinase kinase kinase 3 MAP4K3 RAB8IPL1 MAPK/ERK kinase kinase kinase 3 Germinal center kinase-related protein kinase protein protein human Homo sapiens Human MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHHELPDSDGFLDSSEEIYYTARSNLDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY lcp2_human Lymphocyte cytosolic protein 2 LCP2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein human Homo sapiens Human MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP m4k3_mouse Mitogen-activated protein kinase kinase kinase kinase 3 Map4k3 Germinal center kinase-related protein kinase MAPK/ERK kinase kinase kinase 3 protein protein mouse Mus musculus Mouse MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELPDSDGFFDSSEEIYYTARSNLDLQLEYGQGHQSHCFLGGNKSLLKSVEEELHQRGHVAHLEDDEGDDDDSKHSTMKAKVPPPLPPKPKSIFIPQDTHSAEDGNQGTIKRCPSSGSPAKPSHVPPRPPPPRLPPQKPAVLGNGVNSFQLNGERDGSLYQQQSEQRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHCATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSVSGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFAVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIEFPMPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDAPQTSVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDNTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY kpct_mouse Protein kinase C theta type Prkcq Pkcq nPKC-theta protein protein mouse Mus musculus Mouse MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNARYFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISWDSPLDGSNKSAGPPEPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS lcp2_mouse Lymphocyte cytosolic protein 2 Lcp2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein mouse Mus musculus Mouse MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGGWSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPPNSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRSGNNKTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQKPPLPPAMDRHERNERLGPVTTRKPPVPRHGRGPDRRENDEDDVHQRPLPQPSLPSMSSNTFPSRSVQPSSKNTFPLAHMPGAFSESNIGFQQSASLPPYFSQGPGNRPPLRSEGRNLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGCL map4k3-prkcq-1 1252844 n/a 1252854 unspecified role unspecified role prey prey n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S3B anti-CD3 map4k3-lcp2-1 1252844 n/a 1252854 unspecified role unspecified role prey prey n/a 1252856 unspecified role unspecified role prey prey n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. S4C anti-CD3 lcp2-map4k3-6 1252844 n/a 1252855 unspecified role unspecified role prey prey n/a 1252854 unspecified role unspecified role prey prey n/a 1252856 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. S4B anti-CD3 lcp2-map4k3-3 1252845 n/a 1252856 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252857 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S4A lcp2-map4k3-4 1252845 n/a 1252856 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252857 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S4A lcp2-map4k3-5 1252845 n/a 1252856 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252855 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S4D pervanadate map4k3-prkcq 1252846 n/a 1252857 unspecified role unspecified role bait bait n/a 1252858 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B anti-CD3 map4k3-lcp2 1252846 n/a 1252857 unspecified role unspecified role bait bait n/a 1252858 unspecified role unspecified role prey prey n/a 1252859 unspecified role unspecified role prey prey association association false false false Fig. 2A anti-CD3 lcp2-map4k3 1252847 n/a 1252856 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252855 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 2B lcp2-map4k3-1 1252847 n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252856 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 2B map4k3-prkcq-6 1252848 n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252858 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S3. map4k3-prkcq-7 1252848 n/a 1252858 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252855 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S3A. map4k3-1 1252849 n/a 1252855 putative self putative self putative self putative self region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false Fig. S2C anti-CD3 map4k3-lcp2-2 1252850 n/a 1252859 unspecified role unspecified role prey prey n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252858 unspecified role unspecified role prey prey association association false false false Fig. S3C anti-CD3 map4k3-prkcq-2 1252851 n/a 1252855 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252854 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 1C map4k3-prkcq-3 1252852 n/a 1252854 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252855 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 1C map4k3-prkcq-5 1252853 n/a 1252855 enzyme enzyme neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1252858 enzyme target enzyme target substrate substrate neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thr538p phosphorus containing modified residue phosphorus containing modified residue western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false Fig. 1E