IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ he-2011a-2 The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation he-2011a-1 The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation he-2011a-3 The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation he-2011a-4 The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn PLoS ONE 2011 Only protein-protein interactions imex curation f8rp38_pea protein protein pea Pisum sativum (Garden pea) Garden pea MQSQLVCNGCRNMLLYPRGATNVCCALCNTISPVPPPGMDMSQLYCGGCRTLLMYTRGATSVRCSCCHTVNLAPVSNQVAHVPCANCRTTLMYPYGAPSVKCAVCHYITNINMSNGRVPVPANRPQGTTNLGTLPSTSTSMPQSQGQTVVVENPMSVDSSGKLVSNVVVGVTTDKK impa1_arath Importin subunit alpha-1 IMPA1 KAP1 Karyopherin subunit alpha-1 F3E22.14 T8E24.1 At3g06720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGFPSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPRFVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAVWALGNVAGDSPRCRDLVLGCGALLPLLNQLNEHAKLSMLRNATWTLSNFCRGKPQPHFDQVKPALPALERLIHSDDEEVLTDACWALSYLSDGTNDKIQTVIQAGVVPKLVELLLHHSPSVLIPALRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVPSGGFNFS impa3_arath Importin subunit alpha-3 IMPA3 KAP2 Karyopherin subunit alpha-2 MOS6 Protein MODIFIER OF SNC1 6 T10M13.16 At4g02150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPSAKTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGSATGQTEQDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAGNADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVSQGCIKPLCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNFI impa4_arath Importin subunit alpha-4 IMPA4 T12M4.2 At1g09270 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQLPLGAGLDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIKAGVIPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSASDDVREQAVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNENSKLSMLRNATWTLSNFCRGKPPTPFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGVCPRLVELLGHQSPTVLIPALRTVGNIVTGDDSQTQFIIESGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNNPAAPVGGFKFA q4u6g1_pea LITAF protein protein pea Pisum sativum (Garden pea) Garden pea MGRKEEEEVAVGVPVYERNGIPPNALIGDPKGIPIQQTIYRDTPAPFNCPHCGHTSLTSVRSKISLAAFVGCLMPMMLGVCFLCPSMDCLWHKYHYCPDCHQKVADFEKSDICAVMDPPNWTQESFALARY kap1-f8rp38 1322233 n/a 1322237 unspecified role unspecified role prey prey n/a 1322238 unspecified role unspecified role bait bait physical association physical association false false false 3a ima2-f8rp38-1 1322233 n/a 1322239 unspecified role unspecified role bait bait n/a 1322237 unspecified role unspecified role prey prey physical association physical association false false false 3a ima3-f8rp38 1322233 n/a 1322239 unspecified role unspecified role bait bait n/a 1322237 unspecified role unspecified role prey prey physical association physical association false false false 3a impa4-f8rp38 1322233 n/a 1322237 unspecified role unspecified role prey prey n/a 1322240 unspecified role unspecified role bait bait physical association physical association false false false 3a litaf-f8rp38 1322234 n/a 1322237 unspecified role unspecified role prey prey n/a 1322241 unspecified role unspecified role bait bait physical association physical association false false false text kap1-f8rp38-1 1322235 n/a 1322238 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1322237 unspecified role unspecified role prey prey purified purified zinc finger domain 2-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false zinc finger domain 3-containing region required to bind necessary binding region required to bind range range range range false n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false zinc finger domain 1-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3b, 4 f8rp38-kap1 1322236 n/a 1322238 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1322237 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3c