UniProt UniProt http://www.uniprot.org chang-2011a-6 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation chang-2011a-1 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation chang-2011a-2 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation chang-2011a-5 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation chang-2011a-7 AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL zfan6_human AN1-type zinc finger protein 6 Zinc finger A20 domain-containing protein 3 Associated with PRK1 protein ZFAND6 ZA20D3 AWP1 HT032 protein protein human Homo sapiens Human MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN zfand6-traf2-3 1294849 n/a 1294854 unspecified role unspecified role prey prey n/a 1294855 unspecified role unspecified role bait bait physical association physical association false false false 2c traf2-zfand6-4 1294849 n/a 1294855 unspecified role unspecified role prey prey n/a 1294854 unspecified role unspecified role bait bait physical association physical association false false false 2c traf2-zfand6 1294850 n/a 1294855 unspecified role unspecified role prey prey n/a 1294854 unspecified role unspecified role bait bait physical association physical association false false false no figure traf2-zfand6-1 1294851 n/a 1294855 unspecified role unspecified role prey prey n/a 1294854 unspecified role unspecified role bait bait physical association physical association false false false 1A zfand6-traf2-2 1294852 n/a 1294854 unspecified role unspecified role prey prey n/a 1294855 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2B traf2-ripk1 1294853 n/a 1294854 unspecified role unspecified role bait bait n/a 1294856 unspecified role unspecified role prey prey physical association physical association false false false 6A TNF-alpha stimulation ZFAND6/AWP1 wild type, but not deletion construct dA20 (containing aa 38-208)