mpidb The Microbial Protein Interaction Database biemans_oldehinkel-2011-1 Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation biemans_oldehinkel-2011-2 Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation b7uma6_eco27 Protein-secreting ATPase escN E2348C_3948 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MISEHDSVLEKYPRIQKVLNSTVPALSLNSSTRYEGKIINIGGTIIKARLPKARIGAFYKIEPSQRLAEVIAIDEDEVFLLPFEHVSGMYCGQWLSYQGDEFKIRVGDALLGRLIDGIGRPMESNIVAPYLPFERSLYAEPPDPLLRQVIDQPFILGVRAIDGLLTCGIGQRIGIFAGSGVGKSTLLGMICNGASADIIVLALIGERGREVNEFLALLPQSTLSKCVLVVTTSDRPALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASGEPDVRGGFPPSVFSSLPKLLERAGPAPKGSITAIYTVLLESDNVNDPIGDEVRSILDGHIVLTRELAEENHFPAIDIGLSASRVMHNVVTSEHLRAAAECKKLIATYKNVELLIRIGEYTMGQDPEADKAIKNRKLIQNFIQQSTKDISSYEKTIESLFKVVA b7uma3_eco27 sepQ E2348C_3945 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKPLSSQLNMKINDFYLPLLPVIGTGRLYITSEGHACHAYFREVSGHGIRFTLTYSGYEGRFWISEEQFIQWCQELFPYSESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKDVYPVIENNNGENRLNVIILETTVQSLQHLINDNWQFVPHSNALFFDGYIVPGWTDYPVTELRVGDSLRLYHVDDSQERRCWIVINNPLATVKLSDNNLSVTDVLAADPLCTISSETVMNRIYCVIGTVHIDIHMLRNVQKDDIIDSTGYHLFGGCQLVRNNTTIAYGSIIKINEDFYFTISVVCD b7ugf2_eco27 DUF2786 domain-containing protein E2348C_2638 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKDKYIAKIKKLLRLAKGTSSPEEAANAIAKAQAYMRQHGISENDAELFDIQEAASAGAPSDASTPPRYMHILCDLVCKAFGVECYISGEYRASGSLKRYVRFYGPDSRPEIAAYAFDVLSRQMMAERKKYQDKHCKRCGPSTRVARGDQFCEGWVFGARDVIAVYDVSPEEKSRLELYRKNLHSTKGLRDGDMRTAKACRGAEFAATAGFIAGKNARLHQGVNGQSNRPLALGRV escn-b7ugf2-1 1338887 n/a 1338889 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338890 unspecified role unspecified role prey prey n/a 1338891 unspecified role unspecified role prey prey association association false false false figure 2 escl-sepq 1338887 n/a 1338890 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338889 unspecified role unspecified role prey prey n/a 1338891 unspecified role unspecified role prey prey association association false false false figure 2 b7ugf2-escn 1338887 n/a 1338889 unspecified role unspecified role prey prey n/a 1338890 unspecified role unspecified role prey prey n/a 1338891 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false figure 2 b7ugf2-escn 1338888 n/a 1338889 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338891 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3A b7ugf2-sepq 1338888 n/a 1338890 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338891 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3B sepq-escn 1338888 n/a 1338889 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338890 unspecified role unspecified role bait bait physical association physical association false false false figure 3C, 4 Interaction observed in ESCL -/- cells.