UniProt UniProt http://www.uniprot.org lee-2011b-1 Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. ecoli Escherichia coli (strain K12) pull down pull down anti tag western anti tag western blot anti tag western Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. lee-2011b-2 Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. lee-2011b-3 Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. lee-2011b-4 Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. praf1_human Prenylated Rab acceptor protein 1 PRA1 family protein 1 RABAC1 PRA1 PRAF1 protein protein human Homo sapiens Human MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA a-synuclein-pra1 1307472 n/a PRA1 1307476 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a syn 1307477 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 syn-pra1 1307473 n/a pra1 1307476 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1307477 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false Fig.2 pra1-a-syn 1307474 n/a pra1 1307476 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a syn 1307477 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig.3 a-synuclein-pra1 1307475 n/a syn 1307477 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a PRA1 1307476 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false