UniProt UniProt http://www.uniprot.org schramm-2011-1 A novel mouse synaptonemal complex protein is essential for loading of central element proteins, recombination, and fertility. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schramm S., Fraune J., Naumann R., Hernandez-Hernandez A., Hoog C., Cooke H.J., Alsheimer M., Benavente R. benavente@biozentrum.uni-wuerzburg.de, alsheimer@biozentrum.uni-wuerzburg.de PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation syce3_mouse Synaptonemal complex central element protein 3 Syce3 Tseg2 Testis-specific expressed protein 2 protein protein mouse Mus musculus Mouse MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCKEEMEKNWQELLTETKRKQ syce1_mouse Synaptonemal complex central element protein 1 Syce1 protein protein mouse Mus musculus Mouse MATRPQPLGMEPEGSADLLHGPEGARGQYGSTQKIEDLMDMVKKLQKVGSLEPRIEVLINRINEVQQAKKKASEELGEAQTVWDNLQKELDLLREEKVRLKDILNRKEETLRIMQLHCQEKESEAQRKHSMLQECKERISFLNSQIDKEKAKLRKLRLDFEEHLETLMSQHKDTLEFHKPEHLTKEMCVLDSSKEQLLKEEKLMKVKLEDVRQRLCALGGPEGSSSLIEGLFLRSHEAAAAMQMFKDENKKAEEFLEAAAQQHEQLQQRCHQLQQKRQRLKEELEKHGVQILAHSTQNEEDSSWRMASPKPVEVHEETAQDQERPSSRT syce2_mouse Synaptonemal complex central element protein 2 Syce2 Central element synaptonemal complex protein 1 Cesc1 protein protein mouse Mus musculus Mouse MERHGVAAPPVELKDQEPPAIVESGEHRQSENHEETPGSVAPSASCQLPGPFSSLDSSIETLKKKAQELIENINESRQKDHALMTNFRDSLKMKVSDLTEKLEERMYQVYSHHSKIIQERLQEFTQKMAKINHLEMELKQVCQTVETVYKDLCVQSEVPTCEEQNYKDGEC syce3-syce1 1293128 n/a 1293129 unspecified role unspecified role bait bait myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1293130 unspecified role unspecified role prey prey egfp-syce1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 10 A syce1-syce3 1293128 n/a 1293129 unspecified role unspecified role prey prey myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1293130 unspecified role unspecified role bait bait egfp-syce1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 10B syce3-syce2 1293128 n/a 1293131 unspecified role unspecified role prey prey egfp-syce2 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1293129 unspecified role unspecified role bait bait myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 10 C syce2-syce3 1293128 n/a 1293131 unspecified role unspecified role bait bait egfp-syce2 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1293129 unspecified role unspecified role prey prey myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 10 D