UniProt UniProt http://www.uniprot.org luo-2011b-2 The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation luo-2011b-4 The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. caeel-body muscle Caenorhabditis elegans body muscle body_muscle Body wall muscle confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation luo-2011b-1 The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation luo-2011b-5 The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. caeel-neuron Caenorhabditis elegans neuron neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation luo-2011b-3 The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. caeel Caenorhabditis elegans confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation vps52_caeel Vacuolar protein sorting-associated protein 52 homolog vps-52 tag-197 F08C6.3 protein protein caeel Caenorhabditis elegans MPRTRVNLQKSEANDRSFTISSLEFCLSQLRKADPNLVKKAIASGDGLTESKNDVSTRLSEAHRYSVQQCLDNSEQLAQLHNQLVHCDNVFERLQATLYSFQDNLGSIGQDMKNLQLQSHHIHQELENRQKVRVELSQFVDDIAVSQTMMKTINDTDANDRGFLEALHELHHKITLILQRGNGDAVAVNDTMPILEGLKLKAVVKVREWLLQKMFQFRKPLSNYQVFQHQLLKCRFFYEFLLHHDLISAKELQDEYIDTISKMFFTYFKAYATRLFKLAMKDVATKEDALGSIDFAKPAGLGAIFSSKQHVVRNKATVFSIGQRHQILSDDFLGALIVPHAATQNHQSYQFEALFRSIQLAFVDHYSHEYLFITDFFLVSNDEAIELHNKAMARAMSVVLKSCEEQIALSWDAISLHLCICLCDKFTEVLAEREVPEVSDYWNTVTSFLWTRLNLVMSQHYESVKSVDLKKLMHSGSLDARPHFIVRRYAELTSAHLMIAKASGKEMGAKMEAVLENSEDSIEQLLTRMSAMQQTQKNKHVFLINNYDLILSIIDNEESKHTKIYAIVHELEQKSIDDFVEEMLEPHIGYMIKFVNECESLIVQGHTQLLVRYNDKVGTVVANFNAKWRPAVDSINSECIQLFTNFSLGTTILQTIFTKYVQYINRFTKILSHDVFAKNPVCSQLVNVHQVMLEIKRFKPAY vps51_caeel Vacuolar protein sorting-associated protein 51 homolog vps-51 Protein fat-free homolog B0414.8 protein protein caeel Caenorhabditis elegans MSSVLDVTKPDFDVEAFVVKLLREKSLDGLVKEEEEMVSAVRRLDSDVHQIVYENYNKFLTATNTVRKIQDEFTQLDSEMKSLSRSMSTISTLIGNLDGVLGEKRDDILQLGSSYKVVNSLKHIFDLPHVLRSEFDERNYGEVLRMFKLAEESLSQYKDVPTVQLVLQKSKKIYDMTENQLMDQLRNPASGAELVSEAVDLLLTIGRDEDEVQKVLLTCSEQSLRVDLKELSANHSDVLDLVDKASESFIPNLTLIATTHDRLFEDKREDLITVLKTEMNSLHALVSKVFLSSSDAKDCSIVVRALDRYFRKISTCRYVIPGLDFLPLTIELINAVSKHEIDLSLTRIKEELKNGLNEVRKALINEEKDLSALASKIEQVFVHQVKTALANLLLFTASDVTFANLPPDEFRQSFSFNAHERLLVQAFHRFSELADEYESGAGEIRFVDPRVHLVFAVALQHLSNKSAVYLLNLCREQFSLSPDDGLTDITVVMSEVKTRAQKLVRCYAEKTGLSMGETLIKGCAMLVQPAATPSAVRASVRRLVEEMNTCDSELTLLLGGDSKPKDSRVSRRPITTALDAARDSLWCERIDFHLQIHFNRASIITVIVKVVLKIFIESIRLQTYSKFGVEQVQVDCYYLQRCLAALVSDEVVVNSMVDQALSSALKRCQDPVLVHPSRLAQLCEQPPANRPSSQASSLGY vps53_caeel Vacuolar protein sorting-associated protein 53 homolog vps-53 T05G5.8 protein protein caeel Caenorhabditis elegans MEEPTTSELKLSDNVMNEISDMCITEYCKPNMSLMAQINELFPTEQSLTQLDSIIASVEGEIGELDNELAYLVETNANVSERGEEALKHAQDAMIELEKSIGSIRERTKSSDEIVREMTRDIKQLDIAKRNLTASITTLHHLHILLTGVESLGAWVDKKDYSSIARQLPAILNVLQLFDAYKESDQIANLSGQLDKLKASLTIQLAKDLKNAFQTGQLSDRITDMCRVAAALEGNVKENFVKWFIEQQLSEYVIIYADNEEGAWLDKVDDRYKWFVRKLTDFERAGLSNIFPADWHMGRRLTSEFCTVTRDILYRIMTRRRQDLDWKLLGHAIQHTKMFEALLTKRFPEKDGISFEKAIWSVFDTFLDVFINAQEKTLNEFLDTCASKIRSGEEKPSRESSTHAVPFPSSADMFLLLKKVITESSKLSSEPDALIRDVIGVVRVCLRGYATSCLVAFLPSLGSQQSGAANLFSLIREEIAYPRLTPDQQFLVCCILATADWCAETSIQLQEKLSQRIPGVDISQETEAFYSITNQSLQVLVQDVESTCDAALQSISKVNWTAVDCVGDESPFIGSMRAHLRQAVPLIRDMLSDRRKYFAHFCLKLATQLAHKFVGSLFRCRTISTHGAEQLLLDTHSLKTFLLSVPSIDSIINSKPPTAYVTSVNAALTKAEMILKVVMCSLETVDEFVEQYIKLLPASDAAEMQKVLEMKGVKRQEHSAVLNAYRLKIGASGSDPIQQSNSLTSRIGGALPTVGSAASVSEAFNAVVSMAADGLSDQAVTSSIDKLKRFERLVKRQL vps54_caeel Vacuolar protein sorting-associated protein 54 vps-54 T21C9.2 protein protein caeel Caenorhabditis elegans MKSMDDRTVGLISASSSRASLKIQPEIGYPRICDYCQPIIELMTASEFARHIRQDHTTKEGGSFLCRYGEHGVCQKLPLEGVCDLDFEAHIRRCHTSSQPAGYSSPTSSLVASYTEDSEETASLRSIRLTSDRDTPTIEKKKFTLHSFTQNLSAVLADPSRSRSDLTTFFTRHWGDSFVPTQPVPQSKRLARLADSAFDSYCQSAGESYRRYQAIKRALRLSHADGGVGIGDERQDAEDLPTIFIDPRFTLGDSSTFSDVFTVPANDDLDALKQTLSGRNVIPATPLEIATNRKPGEFRDYEALQNRLEMMHDVVDGRLAGKLVAKTDDFWQVVRSYSGLQEQLANALQCVMVVRKNLKRVDELVCDQSKKIVEVHERYEQKKKLLAKLHDISCLREAQSTVQMMLSQGDYPKAIECIETSLDVLSKELNGVTCFRHLASQLRELYTVIGRMMNEDFASLIQKELGVKPEAGTMIQAEGELSAVLLGLMRMRKYSFIAVLREEIIEGVKSVMRQVIKNQILNNGVDLNDFDPSLTQLGEPVRRMKHADFLKTVKAVMDEEFYFCKRLEALQDILLETVERANPLHRHGSEDIIVERIEEAKDIHESESDDEVGTTFSKSASSGGFSVGGSALSSNASATTLLSIEVRSEAFLRHVLPLIAEFGHQCAQQRISRLLIARAKNASVTEATTPTQLSECIKLVKEFQSKCDKEGWYSTQNQKVGGLGRSVNKLSMDYIEKFHAARKIRIGNMLDTELWKATDVSIVDQNIVDMAMETGQLRNTKRIDDGPIKKSFKRTESAVTIDSTTSTSNQIQGVIVDEENYVVVGSSITMIQLLSDYCEAISEMPSFSQDWNSRVVELLKTFNSRCCQLILGAGALQLVGLKTISVRNLALAGRSLELVCRFIPMVHDEMDRVLPENRKSLLRYFKQVESEYRDHVNEIAAKLISVIAHYTTNCLGMWDVKGVIPSPEFQQICRHMLKFHNGLVGIMPRDQIEALFRQVHENFKANLREHVTGMGITPHDPLKYGYVTKDYMFYQQNVKNMESCRNLELESLNDIMFE stx5_caeel Putative syntaxin-5 syx-5 syn-3 F55A11.2 protein protein caeel Caenorhabditis elegans MSDFHNIRSRRRIPEASSYSTVDFDYDPDQKNHTSAVAPTSFAYSSLTTVFNASASQLWNSAQEALVSSYDTAEGTESIDADRSKVVETLESLSIFGNPLDHIIITMPSRDRTSEFRATAKSYEMKAAANGIRPQPKHEMLSESVQFNQLAKRIGKELSQTCAKMEKLAEYAKKKSCYEERSQIDHLSSIVKSDITGLNKQIGQLQEFSKRRAGNMKNQNSGHIQLVVVGLQSKLANVGKDYQSVLEISTETMKAEKNRRDKFSSGAAVPMGLPSSSSGANVRSKLLQDDEQHGSSSIALDMGALSNMQSQQTMQQRDSSLEYAQARSNTMATIEGSISELGQIFSQLASLVSEQGEMITRIDSNVEDTALNIDMAHSELVRYLQNISKNRWLMIQVFGVLMVFFVVFVLFLT cut19_caeel Cuticlin-like protein 19 cutl-19 syx-16 ZC155.5 protein protein caeel Caenorhabditis elegans MVEYNRIFCVLVIFSTTIKCEYSELMNQKIGVRVEVLNMIYENETTITSTGHPRCRLTLHKSGWDRDTCSSPQFKLNDTLSWSTRVCYKWVCDTTKYAMRVESCWIGSPNMSVYILRDDGCTIEKAILTSPVYTSFNRAAAIGWMAVRQKNMKYMHVGCTIRLCHLCDPKCQTITPPRTCNDNRADDYEAMWNSSSRVKNLCFPEPSTTENLNLNFGNSPFQNVGNIIILLLVFLLR o18230_caeel vti-1 Y57G11C.4 CELE_Y57G11C.4 protein protein caeel Caenorhabditis elegans MSNQSATVEQLSGFEKQYSLQTAEITSKIGRVHTLPSSDRAGAVQEIRKSLEEVNDLLDQMELVVRELESNTTERTKYELRVRSYQSDKKQLDTELEKAIKRVREEADRDELLAFDDQLDEHRQEDQLIANTQRLERSTRKVQDAHRIAVETEQIGAEMLSNLASQRETIGRSRDRLRQSNADLGRANKTLSSMIRRAIQNRLLLLIVTFLLSFMFLYIVYKAI gosr2_caeel Golgi SNAP receptor complex member 2 homolog memb-1 memb-1 gosr-2.1 B0272.2 protein protein caeel Caenorhabditis elegans MEALYQSTNFLLQKVQHDLGRLEGTQNEQDAQVVVQCIYGDVITLKENCQTLDNYVSREPPARRQAARMRVDQLRADVHRVDMAVSAVHTRMTQRWRAATERDELLRTRYRPNDTALSIGDHELLLNDRLQSSHTHLDDLISQGSAVLENLKSQHLNLRGVGRKMHEIGQALGLSNSTLQVIDRRVREDWILFVIGCIVCCIFMYAFYRFWRG q21499_caeel M03E7.5 memb-2 CELE_M03E7.5 protein protein caeel Caenorhabditis elegans MDTQLKATREEIDNVQLLLIAIERQTGNHEVDRLIQDANSSLMKTETHMFRLESQLGREPAPVRQKASFKMDQLKSDVCLIKNSLRTMTNRHTNRKKQAEEKKALLKQRFTTNQETRVNLEFDEELNLNDKLKYSDNMIDQMLAQGASVFEDLQKQKYNLLSIRKRFHFLTKSLGISDTTIRLIEKRVREDKKLFMIGVICCLIFMFCFYYWWQYC rab6a_caeel Ras-related protein rab-6.1 rab-6.1 F59B2.7 protein protein caeel Caenorhabditis elegans MADFTNNALKKFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALPGIVQEETPEQPNIVIMNPPKDAEESQGRQCPC rab6b_caeel Ras-related protein rab-6.2 rab-6.2 T25G12.4 protein protein caeel Caenorhabditis elegans MSDFGNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDDPVEPPNVVTMDPIRQRQIVTDEGSCWC vps51-vps_52 1330316 n/a 1330321 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1330322 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 2C. vps51-vps_53 1330316 n/a 1330323 unspecified role unspecified role prey prey n/a 1330322 unspecified role unspecified role bait bait physical association physical association false false false Figure 2C. vps51-vps_54 1330316 n/a 1330324 unspecified role unspecified role prey prey n/a 1330322 unspecified role unspecified role bait bait physical association physical association false false false Figure 2C. vps51-vps51 1330316 n/a 1330322 unspecified role unspecified role bait bait n/a 1330322 unspecified role unspecified role prey prey physical association physical association false false false Figure 2C. vps52-vps51 1330316 n/a 1330321 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1330322 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 2C. vps_52-vps_52 1330316 n/a 1330321 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1330321 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 2C. vps_52-vps_53-1 1330316 n/a 1330323 unspecified role unspecified role prey prey n/a 1330321 unspecified role unspecified role bait bait physical association physical association false false false Figure 2C. vps_52-vps_54 1330316 n/a 1330321 unspecified role unspecified role bait bait n/a 1330324 unspecified role unspecified role prey prey physical association physical association false false false Figure 2C. vps_54-vps_53-1 1330316 n/a 1330324 unspecified role unspecified role bait bait n/a 1330323 unspecified role unspecified role prey prey physical association physical association false false false Figure 2C. vps51-syn_3 1330316 n/a 1330325 unspecified role unspecified role prey prey n/a 1330322 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps51-syx_16 1330316 n/a 1330326 unspecified role unspecified role prey prey n/a 1330322 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps51-vti_1 1330316 n/a 1330322 unspecified role unspecified role bait bait n/a 1330327 unspecified role unspecified role prey prey physical association physical association false false false Figure 8A. vps_52-gosr_2_1 1330316 n/a 1330328 unspecified role unspecified role prey prey n/a 1330321 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps51-gosr_2_1-1 1330316 n/a 1330328 unspecified role unspecified role prey prey n/a 1330322 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps_52-syx_5 1330316 n/a 1330325 unspecified role unspecified role prey prey n/a 1330321 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps_52-syx_16 1330316 n/a 1330321 unspecified role unspecified role bait bait n/a 1330326 unspecified role unspecified role prey prey physical association physical association false false false Figure 8A. vps_52-memb_2 1330316 n/a 1330321 unspecified role unspecified role bait bait n/a 1330329 unspecified role unspecified role prey prey physical association physical association false false false Figure 8A. vps_54-memb_2 1330316 n/a 1330324 unspecified role unspecified role bait bait n/a 1330329 unspecified role unspecified role prey prey physical association physical association false false false Figure 8A. vps_54-syx_5 1330316 n/a 1330325 unspecified role unspecified role prey prey n/a 1330324 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A. vps_52-vps51 1330317 n/a 1330322 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330321 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 2A. vps_52-vps_53-2 1330317 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330321 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 2A. vps_52-vps_54-1 1330317 n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330321 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 2A. vps_53-vps_54 1330317 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 2A. vps_52-vps_54-2 1330317 n/a 1330321 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry exp feature detect experimental feature detection exp feature detect c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4A. Colocalization observed in C. elegans organism with a vps-51 (tm4275) gene knock-out background. vps_53-vps_54-1 1330317 n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 4A. Colocalization observed in C. elegans organism with a vps-51 (ok853) gene knock-out background. vps_52-vps_54-3 1330317 n/a 1330321 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4A. Colocalization observed in C. elegans organism with a vps-53 (ok2864) gene knock-out background. vps_53-vps_54-2 1330317 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330324 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4A. Colocalization observed in C. elegans organism with a vps-54 (ok1463) gene knock-out background. vps-51_vps-53 1330318 n/a 1330322 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro n/a 1330323 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false Figure 2 B. vps_52-vps_53 1330318 n/a 1330323 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330321 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 2 B. vps_54-vps_53 1330318 n/a 1330324 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330323 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 2 B. vps_54-vps_52 1330318 n/a 1330321 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330324 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 2 B. rab_6_1-vps_52 1330318 n/a 1330330 unspecified role unspecified role bait bait gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330321 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 3F. vps_52-rab_6_2 1330318 n/a 1330331 unspecified role unspecified role prey prey gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330321 unspecified role unspecified role bait bait mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 3F. memb_2-vps_53 1330319 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330329 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 8B. stx_5-vps_53 1330319 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330325 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 8B. vps_53-vti_1 1330319 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330327 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 8B. syx_16-vps_53 1330319 n/a 1330323 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330326 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 8B. rab_6_1-vps_52-1 1330320 n/a 1330321 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1330330 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag exp feature detect experimental feature detection exp feature detect n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure 3E. rab_6_2-vps_52-1 1330320 n/a 1330331 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1330321 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 3E.