mpidb The Microbial Protein Interaction Database silva_herzog-2011-2 Scc1 (CP0432) and Scc4 (CP0033) function as a type III secretion chaperone for CopN of Chlamydia pneumoniae. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Silva-Herzog E., Joseph S.S., Avery A.K., Coba J.A., Wolf K., Fields K.A., Plano G.V. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation silva_herzog-2011-1 Scc1 (CP0432) and Scc4 (CP0033) function as a type III secretion chaperone for CopN of Chlamydia pneumoniae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Silva-Herzog E., Joseph S.S., Avery A.K., Coba J.A., Wolf K., Fields K.A., Plano G.V. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation y713_chlpn Protein CPn_0713/CP_0033/CPj0713/CpB0740 CP_0033 CPj0713 CPn_0713 CpB0740 protein protein chlpn chlpn Chlamydophila pneumoniae MLEKLIKNFATYMGITSTLELDADGAYVLPISEVVKVRAQQNADNEIVLSASLGALPPSADTAKLYLQMMIGNLFGRETGGSALGLDSEGNVVMVRRFSGDTTYDDFVRHVESFMNFSETWLSDLGLGKQ q9z8l4_chlpn lcrE CPn_0324 BN1224_CV15_B_02610 BN1224_DC9_BL_00250 BN1224_GiD_A_03370 BN1224_H12_DC_00070 BN1224_MUL2216_E_00610 BN1224_PB1_B_03230 BN1224_Panola_E_01460 BN1224_U1271_C_01640 BN1224_UZG1_A_03360 BN1224_Wien2_E_01090 BN1224_YK41_BG_00220 CWL029c_C_01640 CP_0433 protein protein chlpn chlpn Chlamydophila pneumoniae MAASGGTGGLGGTQGVNLAAVEAAAAKADAAEVVASQEGSEMNMIQQSQDLTNPAAATRTKKKEEKFQTLESRKKGEAGKAEKKSESTEEKPDTDLADKYASGNSEISGQELRGLRDAIGDDASPEDILALVQEKIKDPALQSTALDYLVQTTPPSQGKLKEALIQARNTHTEQFGRTAIGAKNILFASQEYADQLNVSPSGLRSLYLEVTGDTHTCDQLLSMLQDRYTYQDMAIVSSFLMKGMATELKRQGPYVPSAQLQVLMTETRNLQAVLTSYDYFESRVPILLDSLKAEGIQTPSDLNFVKVAESYHKIINDKFPTASKVEREVRNLIGDDVDSVTGVLNLFFSALRQTSSRLFSSADKRQQLGAMIANALDAVNINNEDYPKASDFPKPYPWS q9z8l3_chlpn sycE BN1224_CV15_B_02620 BN1224_GiD_A_03380 BN1224_H12_DC_00080 BN1224_MUL2216_E_00620 BN1224_PB1_B_03240 BN1224_Panola_E_01470 BN1224_U1271_C_01650 BN1224_UZG1_A_03370 BN1224_Wien2_E_01100 BN1224_YK41_BG_00230 CWL029c_C_01650 CP_0432 CPn_0325 protein protein chlpn chlpn Chlamydophila pneumoniae MQNQYEQLLESLAPLLNTTLAPDKNNSCLIRFSDTHVPVQIEEDGNSGDLAVSTLLGTLPENVFRERIFKAALSVNGSFQSSIKGILGYGEVTQQLYLSDILSMNYLNGEKLFEYLKLFSLHAKIWMESLRTGNLPDLHVLGIYYVA q9z6n8_chlpn lcrH_2 BN1224_CV15_C_05180 BN1224_DC9_CL_00460 BN1224_GiD_B_00580 BN1224_H12_FM_00160 BN1224_MUL2216_G_00300 BN1224_PB1_B_10630 BN1224_Panola_M_00490 BN1224_U1271_C_09080 BN1224_UZG1_C_00880 BN1224_Wien2_I_00600 BN1224_YK41_CE_00160 CWL029c_G_00490 CP_0832 CPn_1021 protein protein chlpn chlpn Chlamydophila pneumoniae MSHLNYLLEKIAASSKEDFPFPDDLESYLEGYVPDKNIALDTYQKIFKISSEDLEKVYKEGYHAYLDKDYAKSITVFRWLVFFNPFVSKFWFSLGASLHMSEQYSQALHAYGVTAVLRDKDPYPHYYAYICYTLTNEHEEAEKALEMAWVRAQHKPLYNELKEEILDIRKHK lcre-q9z6n8-2 1338552 n/a 1338554 unspecified role unspecified role prey prey not-defined-1225068493 1338555 unspecified role unspecified role bait bait region Q9Z8L4-1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q9z8l4-- Q9Z8L4-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338556 unspecified role unspecified role prey prey association association false false false figure 2B, figure 3 shows mutants. lcre-q9z6n8-3 1338552 not-defined-1225068493 1338555 unspecified role unspecified role bait bait q9z8l4-1-220 Q9Z8L4-1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q9z8l4-- Q9Z8L4-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338557 unspecified role unspecified role prey prey physical association physical association false false false figure 2B, figure 3 shows mutants. lcre-q9z6n8-4 1338552 n/a 1338556 unspecified role unspecified role prey prey not-defined-1225068493 1338555 unspecified role unspecified role bait bait q9z8l4-- Q9Z8L4-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1338557 unspecified role unspecified role prey prey n/a 1338554 unspecified role unspecified role prey prey association association false false false figure 2B, figure 3 shows mutants. lcre-q9z6n8 1338553 not-defined-1739552558 1338555 unspecified role unspecified role bait bait not-defined-440522318 1338557 unspecified role unspecified role prey prey physical association physical association false false false syce-y713 1338553 not-defined-196822311 1338556 unspecified role unspecified role bait bait not-defined-533120437 1338554 unspecified role unspecified role prey prey physical association physical association false false false