mpidb The Microbial Protein Interaction Database sun-2011b-1 An antirepressor, SrpR, is involved in transcriptional regulation of the SrpABC solvent tolerance efflux pump of Pseudomonas putida S12. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sun X., Zahir Z., Lynch K.H., Dennis J.J. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation srps_psepu HTH-type transcriptional regulator SrpS srpS Solvent efflux pump srpABC operon corepressor protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MNQSDENVGKAGGIQVIARAASIMRALGSHPHGLSLAAIAQLVGLPRSTVQRIINALEEEFLVEALGPAGGFRLGPALGQLINQAQSDILSLVKPYLRSLAEELEESVCLASLAGDKIYVLDRIVSERELRVVFPIGINVPAAATAAGKVLLAALPDETLQAALGEQLPVFTSNTLRRKALVKQLSEVRQSGFASDLDEHIDGVCSFATLLDTYLGYYSLAVVMPSSRASKQSDLIKKALLQSKQNIERAIGRASKKAP srpr_psepu HTH-type transcriptional regulator SrpR srpR Solvent efflux pump srpABC operon corepressor protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MARKTAAEAEETRQRIIDAALEVFVAQGVSDATLDQIARKAGVTRGAVYWHFNGKLEVLQAVLASRQHPLELDFTPDLGIERSWEAVVVAMLDAVHSPQSKQFSEILIYQGLDESGLIHNRMVQASDRFLQYIHQVLRHAVTQGELPINLDLQTSIGVFKGLITGLLYEGLRSKDQQAQIIKVALGSFWALLREPPRFLLCEEAQIKQVKSFE srpr-srps 1338363 not-defined-1386329006 1338364 unspecified role unspecified role prey prey q9r9u0-- Q9R9U0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-2099525351 1338365 unspecified role unspecified role bait bait q9r9t9-- Q9R9T9-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 5