NTNU NTNU, Norwegian University of Science and Technology www.ntnu.no/home chen-2011f-1 Dynamic regulation of PDX-1 and FoxO1 expression by FoxA2 in dexamethasone-induced pancreatic β-cells dysfunction. rat-rin_5f Rattus norvegicus rin_5f Rat islet cell tumour ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Chen F., Zhu Y., Tang X., Sun Y., Jia W., Sun Y., Han X. hanxiao@njmu.edu.cn Endocrinology (0013-7227) 2011 imex curation foxo1_rat_gene forkhead box O1 gene gene rat Rattus norvegicus (Rat) Rat foxa2_rat Hepatocyte nuclear factor 3-beta Foxa2 Hnf3b Tcf-3b Tcf3b Forkhead box protein A2 protein protein rat Rattus norvegicus (Rat) Rat MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDFLKVPRAPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCENELALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS pdx1_rat_gene pancreatic and duodenal homeobox 1 gene gene rat Rattus norvegicus (Rat) Rat foxa2-foxo1 1295798 n/a 1295799 unspecified role unspecified role prey prey n/a 1295800 unspecified role unspecified role bait bait association association false false false Fig 3 FoxA2 could bind to FoxO1 promoters. A, FoxA2 bound directly to the FoxO1 promoter (−1219/−1006 bp, 214 bp) in RINm5F cells in a ChIP analysis. B, FoxA2 did not bind to another FoxO1 promoter (−985/−761 bp, 225 bp) in RINm5F cells in the ChIP assay. foxa2-pdx1 1295798 n/a 1295801 unspecified role unspecified role prey prey n/a 1295800 unspecified role unspecified role bait bait association association false false false Fig4A: The capacity of FoxA2 binding to the PDX-1 promoter was determined using ChIP-qPCR analysis in RINm5F cells treated with DEX (100 nM) at indicated times. Dexamethasone