UniProt UniProt http://www.uniprot.org matsumoto-2001-1 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Praloran V., Bartocci A. kanazawa@bio.sci.osaka-u.ac.jp Rat brain cDNA Methods Mol. Biol. (1064-3745) 1990 mimix curation matsumoto-2001-2 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting polyclonal western polyclonal antibody western blot polyclonal western Praloran V., Bartocci A. kanazawa@bio.sci.osaka-u.ac.jp Rat brain cDNA Methods Mol. Biol. (1064-3745) 1990 mimix curation matsumoto-2001-3 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Praloran V., Bartocci A. kanazawa@bio.sci.osaka-u.ac.jp Rat brain cDNA Methods Mol. Biol. (1064-3745) 1990 mimix curation matsumoto-2001-4 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Praloran V., Bartocci A. kanazawa@bio.sci.osaka-u.ac.jp Rat brain cDNA Methods Mol. Biol. (1064-3745) 1990 mimix curation chp1_rat Calcineurin B homologous protein 1 Chp1 Calcineurin B-like protein Calcium-binding protein CHP Calcium-binding protein p22 Chp EF-hand calcium-binding domain-containing protein p22 protein protein rat Rattus norvegicus (Rat) Rat MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH st17b_rat Serine/threonine-protein kinase 17B Stk17b Drak2 DAP kinase-related apoptosis-inducing protein kinase 2 protein protein rat Rattus norvegicus (Rat) Rat MSRRRFDCRSISGLLTTTPQTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHPEETSESSQTQDLSLRSSEDKTPKSCNGSCGDREDKENIPEDDSLLSKRFRFDDSLPSPHELVPDLFC chp-stk17b-1 1295808 n/a 1295812 unspecified role unspecified role bait bait n/a 1295813 unspecified role unspecified role prey prey physical association physical association false false false table 1 stk17b-chp-1 1295809 n/a 1295813 unspecified role unspecified role bait bait n/a 1295812 unspecified role unspecified role prey prey direct interaction direct interaction false false false 2 chp-stk17b-5 1295810 n/a 1295813 unspecified role unspecified role prey prey n/a 1295812 unspecified role unspecified role bait bait physical association physical association false false false 3 chp-stk17b-6 1295811 n/a 1295812 unspecified role unspecified role neutral component neutral component n/a 1295813 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6H