mpidb The Microbial Protein Interaction Database sydor-2011-1 Effects of metal on the biochemical properties of Helicobacter pylori HypB, a maturation factor of [NiFe]-hydrogenase and urease. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sydor A.M., Liu J., Zamble D.B. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation hypb_helpy Hydrogenase/urease maturation factor HypB hypB HP_0900 Hydrogenase/urease nickel incorporation protein HypB protein protein helpy Helicobacter pylori Campylobacter pylori MSEQRQESLQNNPNLSKKDVKIVEKILSKNDIKAAEMKERYLKEGLYVLNFMSSPGSGKTTMLENLADFKDFKFCVVEGDLQTNRDADRLRKKGVSAHQITTGEACHLEASMIEGAFDLLKDEGALEKSDFLIIENVGNLVCPSSYNLGAAMNIVLLSVPEGDDKVLKYPTMFMCADAVIISKADMVEVFNFRVSQVKEDMQKLKPEAPIFLMSSKDPKSLEDFKNFLLEKKRENYQSTHSF hypb-3 1338228 n/a 1338229 unspecified role unspecified role neutral component neutral component O25560:p.Cys106_His107delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false figure 4 Metal-dependent dimerization observed in the presence of Ni(II) but not Zn(II).