UniProt UniProt http://www.uniprot.org hafner-2010-1 Regulation of the mPTP by SIRT3-mediated deacetylation of CypD at lysine 166 suppresses age-related cardiac hypertrophy. in vitro In vitro deacetylase assay deacetylase assay western blot western blot Immuno blot Immuno blot Hafner A.V., Dai J., Gomes A.P., Xiao C.Y., Palmeira C.M., Rosenzweig A., Sinclair D.A. FLAG-tagged SIRT3 and its mutant construct have been IPed from transfected HEK293T cells, then incubated with purified CypD. CoIP experiments with tagged constructs fig. 3B (mouse FLAG-CypD and human HA-SIRT3) omitted as the experimental host system is not specified. david_Sinclair@hms.harvard.edu Aging (Albany NY) 2010 Only protein-protein interactions imex curation sir3_human NAD-dependent protein deacetylase sirtuin-3, mitochondrial SIRT3 SIR2L3 SIR2-like protein 3 Regulatory protein SIR2 homolog 3 protein protein human Homo sapiens Human MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK ppif_mouse Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein mouse Mus musculus Mouse MLALRCGPRLLGLLSGPRSAPLLLSATRTCSDGGARGANSSSGNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS ppif-sirt3-1 1350019 n/a 1350020 enzyme enzyme neutral component neutral component Q9NTG7:p.His248Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1350021 enzyme target enzyme target substrate substrate neutral component neutral component purified purified deacetylation deacetylation reaction deacetylation false false false 3D