IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2010d-2 Identification of transmembrane protein 88 (TMEM88) as a dishevelled-binding protein. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Lee H.J., Finkelstein D., Li X., Wu D., Shi D.L., Zheng J.J. jie.zheng@stjude.org, hojin.lee@stjude.org J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation lee-2010d-1 Identification of transmembrane protein 88 (TMEM88) as a dishevelled-binding protein. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Lee H.J., Finkelstein D., Li X., Wu D., Shi D.L., Zheng J.J. jie.zheng@stjude.org, hojin.lee@stjude.org J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation dvl1_mouse Segment polarity protein dishevelled homolog DVL-1 Dvl1 Dvl DSH homolog 1 protein protein mouse Mus musculus Mouse MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRDLGLPPDSASTVLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLVRKHKCRRRKQRLRQTDRASSFSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFSCGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSGSESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM tmm88_mouse Transmembrane protein 88 Tmem88 protein protein mouse Mus musculus Mouse MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIMLGFGFLCHSQFLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLADCLVPYSRALYRRRRIPQPKQIPVSPGSRSVPTPGKVWV val-trp-val Val-trp-val peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VWV dvl1-tmem88-1 1293717 n/a 1293719 unspecified role unspecified role neutral component neutral component pdz-domain containing fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P51141:p.Thr334Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1293720 unspecified role unspecified role neutral component neutral component purified purified c-terminal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1293717 2e dvl1-val_trp_val 1293717 n/a 1293719 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P51141:p.Thr334Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false pdz-domain containing fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1293721 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1293717 2e dvl1-tmem88 1293718 n/a 1293719 unspecified role unspecified role neutral component neutral component pdz-domain containing fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P51141:p.Thr334Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false 15n label 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1293720 unspecified role unspecified role neutral component neutral component purified purified c-terminal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2a, 2b and 2c