mpidb The Microbial Protein Interaction Database venkatesh-2010-1 BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS ecolx Escherichia coli gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation venkatesh-2010-2 BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation bglj_ecoli Transcriptional activator protein BglJ yjjR bglJ b4366 JW5955 protein protein ecoli Escherichia coli (strain K12) MEHSRIKKRNVALIEKCVMSSIGIESLFRKFAGNPYKLHTYTSQESFQDAMSRISFAAVIFSFSAMRSERREGLSCLTELAIKFPRTRRLVIADDDIEARLIGSLSPSPLDGVLSKASTLEIFHQELFLSLNGVRQATDRLNNQWYINQSRTLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLLEAADILLCMRHCETSNVLHPY rcsb_ecoli Transcriptional regulatory protein RcsB rcsB Capsular synthesis regulator component B JW2205 b2217 protein protein ecoli Escherichia coli (strain K12) MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD This sequence has been withdrawn from Uniprot. A78D1BD3004E0680 rcsa_ecoli Transcriptional regulatory protein RcsA rcsA Colanic acid capsular biosynthesis activation protein A JW1935 b1951 protein protein ecoli Escherichia coli (strain K12) MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR This sequence has been withdrawn from Uniprot. 6DAA22097807AF62 yjjq_ecoli Putative transcription factor YjjQ yjjQ JW4329 b4365 protein protein ecoli Escherichia coli (strain K12) MLPGCCKNGIVISKIPVMQAGLKEVMRTHFPEYEIISSASAEDLTLLQLRRSGLVIADLAGESEDPRSVCEHYYSLISQYREIHWVFMVSRSWYSQAVELLMCPTATLLSDVEPIENLVKTVRSGNTHAERISAMLTSPAMTETHDFSYRSVILTLSERKVLRLLGKGWGINQIASLLKKSNKTISAQKNSAMRRLAIHSNAEMYAWINSAQGARELNLPSVYGDAAEWNTAELRREMSHS bglj-rcsb 1337931 not-defined-1311384624 1337933 unspecified role unspecified role bait bait not-defined-1523840936 1337934 unspecified role unspecified role prey prey physical association physical association false false false figure 2C rcsa-rcsb-2 1337931 not-defined-1542387971 1337935 unspecified role unspecified role bait bait not-defined-41091185 1337934 unspecified role unspecified role prey prey P0DMC7:p.Asp56Glu P69407-56-56 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 2C rcsb-rcsb 1337931 not-defined-1852666259 1337934 unspecified role unspecified role bait bait not-defined-822912650 1337934 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2B bglj-bglj 1337931 not-defined-528843059 1337933 unspecified role unspecified role bait bait not-defined-1482342779 1337933 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2B yjjq-yjjq 1337931 not-defined-838079484 1337936 unspecified role unspecified role prey prey not-defined-2126603027 1337936 unspecified role unspecified role bait bait physical association physical association false false false figure 2B rcsb-bglj 1337932 not-defined-1500805451 1337934 unspecified role unspecified role bait bait p69407-- P69407-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1209182230 1337933 unspecified role unspecified role prey prey p39404-- P39404-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3