UniProt UniProt http://www.uniprot.org mcgee-2011-2 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot McGee A.M., Baines C.P. Cardiac mitochondrial lysate was used. Origin and features of used tagged constructs and recombinant proteins according cited supplier. Authors confirmed that PPIF gene products have been used (often referred to as CypD). bainesc@missouri.edu Biochem. J. (0264-6021) 2011 Only protein-protein interactions imex curation mcgee-2011-1 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death. mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot McGee A.M., Baines C.P. Cardiac mitochondrial lysate was used. Origin and features of used tagged constructs and recombinant proteins according cited supplier. Authors confirmed that PPIF gene products have been used (often referred to as CypD). bainesc@missouri.edu Biochem. J. (0264-6021) 2011 Only protein-protein interactions imex curation ppif_mouse Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein mouse Mus musculus Mouse MLALRCGPRLLGLLSGPRSAPLLLSATRTCSDGGARGANSSSGNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ c1qbp_mouse Complement component 1 Q subcomponent-binding protein, mitochondrial Glycoprotein gC1qBP GC1q-R protein C1qbp Gc1qbp protein protein mouse Mus musculus Mouse MLPLLRCVPRSLGAASGLRTAIPAQPLRHLLQPAPRPCLRPFGLLSVRAGSARRSGLLQPPVPCACGCGALHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPERTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ ppif_human Peptidyl-prolyl cis-trans isomerase F, mitochondrial PPIF CYP3 Cyclophilin F Rotamase F Cyclophilin D Mitochondrial cyclophilin protein protein human Homo sapiens Human MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS c1qbp-ppif-1 1350078 n/a 1350080 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] n/a 1350081 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false 5D ppif-c1qbp 1350078 n/a 1350082 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] n/a 1350083 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 5D c1qbp-ppif-3 1350078 n/a 1350083 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1350081 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 5E c1qbp-ppif 1350079 n/a 1350080 unspecified role unspecified role prey prey n/a 1350082 unspecified role unspecified role bait bait physical association physical association false false false 5C