mpidb The Microbial Protein Interaction Database monteil-2010a-1 Crl binds to domain 2 of σ(S) and confers a competitive advantage on a natural rpoS mutant of Salmonella enterica serovar Typhi. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Monteil V., Kolb A., Mayer C., Hoos S., England P., Norel F. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation crl_salti Sigma factor-binding protein Crl STY0364 t2531 crl protein protein salti Salmonella typhi MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA rpos_salti RNA polymerase sigma factor RpoS rpoS Sigma-38 katF STY3049 t2825 Sigma S protein protein salti Salmonella typhi MSQNTLKVHDLNEDAEFDENGVEAFDEKALSEEEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE crl-rpos 1337922 not-defined-358454428 1337923 unspecified role unspecified role bait bait not-defined-1251199706 1337924 unspecified role unspecified role prey prey region P0A2E6-255-330 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region P0A2E6-1-55 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P0A2E6:p.Gly282Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4