mpidb The Microbial Protein Interaction Database suaste_olmo-2010-1 The flagellar protein FliL is essential for swimming in Rhodobacter sphaeroides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Suaste-Olmos F, Domenzain C, Mireles-Rodríguez JC, Poggio S, Osorio A, Dreyfus G, Camarena L J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation suaste_olmo-2010-2 The flagellar protein FliL is essential for swimming in Rhodobacter sphaeroides. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Suaste-Olmos F, Domenzain C, Mireles-Rodríguez JC, Poggio S, Osorio A, Dreyfus G, Camarena L J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q9r7b5_cersp Flagellar protein FliL fliL protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MTDASASLDTKPRRGRGLLRALVFLLLGAFLLAAGFGAGYFYFANPLSPAKDVLRLIERTPEADEPAADPDAPQKVPRPTPERESFVTSYYQFKEPLTTNLRASRRLLQAGIGLSTQYDQKVMDNVARNEVALRSDMLAIVGTFSEEELQDKAGRDRLAELRGAVNARLQQLEGFGGIEAVFFPSFILQ flil-flil 1337872 not-defined-213275971 1337874 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1254060658 1337874 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1337879 1337877 physical association physical association false false false Figure 6B flil-flil-1 1337873 not-defined-1088719748 1337874 unspecified role unspecified role prey prey region Q9R7B5-1-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q9r7b5-- Q9R7B5-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1299203937 1337874 unspecified role unspecified role bait bait region Q9R7B5-1-189 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q9r7b5-- Q9R7B5-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 1337885 1337882 direct interaction direct interaction false false false Figure 6A