mpidb The Microbial Protein Interaction Database sevcikova-2010-2 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation sevcikova-2010-3 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation sevcikova-2010-1 The anti-anti-sigma factor BldG is involved in activation of the stress response sigma factor σ(H) in Streptomyces coelicolor A3(2). in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Sevcikova B., Rezuchova B., Homerova D., Kormanec J. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation rsbv_strco Anti-sigma-B factor antagonist Anti-anti-sigma-B factor SCH5.12c SCO3549 rsbV bldG protein protein strco Streptomyces coelicolor A3(2) MDLSLSTRTVGDRTVVEVGGEIDVYTAPKLREQLVELVNDGSFHLVVDMEGVDFLDSTGLGVLVGGLKRVRAHEGSLRLVCNQERILKIFRITGLTKVFPIHTSVEEAVAATD q9x914_strco SCO3548 protein protein strco Streptomyces coelicolor A3(2) MATVELRFSALPEHVRTARLVAAAVARRAGVDEAVLDEVRLAVGEACTRAVGLHQHVGITAPVKVSLIEEEKQFSIEVGDEAPHAVPGVKTSGDAVDELEAEEDEMGLAVISGLVDDVEVSAGEDGGLIRMTWPTASAVLPPI q9rit0_strco sigH SCO5243 protein protein strco Streptomyces coelicolor A3(2) MRDGDGPVRDEERGTRELPAEGTRSPNEARRTADGIDGIPEQARPHPEDETSPGAAVPGEGQRTGETPVRPVRAEARARERATGGTMSEHERHADGHAPGARGTQGTRHDPQDRSGARLLFAELRTLEKDSPEYAELRNRLVRMHLPLVEHLARRFRNRGEPLDDLTQVATIGLIKSVDRFDPDRGVEFSTYATPTVVGEIKRHFRDKGWAVRVPRRLQELRLALTTATAELSQLHGRSPTVHELAEKLSISEEEVLEGLESANAYSTLSLDVPDTDDESPAVADTLGAEDEALEGVEYRESLKPLLEDLPPREKRILLLRFFGNMTQSQIAQEVGISQMHVSRLLARTLAQLREKLLVEE q9r3x8_strco prsH ushX SCO5244 protein protein strco Streptomyces coelicolor A3(2) MSQIAGEPATQDFVEVRLPAAGAYLSVLRTATAGLAARLDFTLDEIEDLRIAVDEACAILLQQAVPGSVLSCVFRLVDDSLEVTVSAPTTDGHAPSRDTFAWTVLSALAGKVSSAVDEDKTVSISLYKQRGAGPGPT rsbv-q9x914-1 1337789 not-defined-328843392 1337792 unspecified role unspecified role bait bait not-defined-1716908147 1337793 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 sigh-prsh 1337789 not-defined-1489588342 1337794 unspecified role unspecified role bait bait not-defined-1531391623 1337795 unspecified role unspecified role prey prey physical association physical association false false false figure 2 rsbv-prsh 1337789 not-defined-1787085007 1337792 unspecified role unspecified role bait bait not-defined-790319911 1337795 unspecified role unspecified role prey prey physical association physical association false false false figure 2 q9x914-rsbv-1 1337790 not-defined-555306992 1337792 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-749879377 1337793 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Figure 3 prsh-rsbv-1 1337790 not-defined-1542319913 1337792 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-944281084 1337795 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Figure 3 prsh-rsbv 1337791 not-defined-942285885 1337795 unspecified role unspecified role bait bait q9r3x8-- Q9R3X8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-749123324 1337792 unspecified role unspecified role prey prey strco Streptomyces coelicolor A3(2) physical association physical association false false false Figure 1