UniProt UniProt http://www.uniprot.org eleveld_trancikova-2010-4 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation eleveld_trancikova-2010-1 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation eleveld_trancikova-2010-3 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation eleveld_trancikova-2010-5 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation eleveld_trancikova-2010-2 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster confocal microscopy confocal microscopy immunostaining immunostaining Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation dcstp_human Dendritic cell-specific transmembrane protein DCSTAMP Dendrocyte-expressed seven transmembrane protein IL-four-induced protein TM7SF4 Transmembrane 7 superfamily member 4 protein protein human Homo sapiens Human MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSHVLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPILIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISVFEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG os9_human Protein OS-9 OS9 Amplified in osteosarcoma 9 protein protein human Homo sapiens Human MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF tm7sf4-creb3-1 1284949 n/a 1284954 unspecified role unspecified role bait bait n/a 1284955 unspecified role unspecified role prey prey physical association physical association false false false 1B os9-creb3 1284949 n/a 1284955 unspecified role unspecified role prey prey n/a 1284956 unspecified role unspecified role bait bait physical association physical association false false false Supplementary figure 1 tm7sf4-creb3-3 1284950 n/a 1284955 unspecified role unspecified role prey prey n/a 1284954 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3A tm7sf4-creb3-2 1284950 n/a 1284955 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1284954 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1284971 1284969 physical association physical association false false false 3B tm7sf4-creb3 1284951 n/a 1284954 unspecified role unspecified role bait bait n/a 1284955 unspecified role unspecified role prey prey physical association physical association false false false No figure creb3-tm7sf4 1284952 n/a 1284955 unspecified role unspecified role neutral component neutral component n/a 1284954 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 and S2A creb3-tm7sf4-2 1284953 n/a 1284954 unspecified role unspecified role neutral component neutral component n/a 1284955 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 and S2A