mpidb The Microbial Protein Interaction Database de_paz-2010-1 Functional dissection of the conjugative coupling protein TrwB. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined de Paz H.D., Larrea D., Zunzunegui S., Dehio C., de la Cruz F., Llosa M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation o50337_ecolx trwE protein protein ecolx Escherichia coli MFGRKKGDVIDAGAELERAEQERIEGEYGASELASERRPHTPGARTLLMVLLCVIAVVLVTLSYKAYKVRGVVEDDDAQPQQVVRQVIPGYTPRPIRPEPENVPEPPQPTTSVPAIQPAPVTQPVRPQPTGPREKTPYELARERMLRSGLTAGSGGGEDLPRPQGGDVPAGGLMGGGGGGGELAEKLQPMRLSGSSAGRLGNRDMLITQGTQLDCVLETRLVTTQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQGGLRQGQARIFVQWSRIETPSGVVINLDSPGTGPLGEAGLGGWIDRHFWERFGGAIMISLIGDLGDWASRQGSRQGNNSIQFSNTANGVESAAAEALRNSINIPPTLYKNQGERVNILVARDLDFSDVYSLESIPTK q04230_ecolx trwB protein protein ecolx Escherichia coli MHPDDQRKVSAGIVIVLPLIFWITAVQKTEVLGSPKLLALWELMKLTPQKPILLLSALGGLAVGVLFVWLLNSVGQGEFGGAPFKRFLRGTRIVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSDKLPEHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLWLFIDELASLEKLASLADALTKGRKAGLRVVAGLQSTSQLDDVYGVKEAQTLRASFRSLVVLGGSRTDPKTNEDMSLSLGEHEVERDRYSKNTGKHHSTGRALERVRERVVMPAEIANLPDLTAYVGFAGNRPIAKVPLEIKQFANRQPAFVEGTI q7x251_9hyph trwE protein protein bartonella tribocoru Bartonella tribocorum MFDNKEGDEKGKKLDNIEQKHIENAYESSELGSEHRPTIPGTRVLLIVGLIVIVAVPIALTWKAFKMRNTVEIEEEKPQQTVQQIIPSYTPRVIEEPKLVEESEKSTPIEDSSLDISPALAKLLQTTVPPHMIQDSEELARRRMLSSSLNNGGSEGSTETNKASNDNSGALNLQPVRLGQSHAAQLRNRDLLITQGTQIDCTLETKIITSQPGMTTCHLTRDIYSTSGRVVLLDRGSKVVGFYQSGLQQGQTRVFVQWLRIETPSGVIVNLDSPGTGPLGEAGIGGWVDRHFWERFSGAIMVSIIGDLGEWVRGKINKSSKENKENAQPQGAHNAELIVNDVIQNSINITPTLYKHQGERVNIFVARDLDFSDVYSLVTR trwb-trwe 1337299 not-defined-1453660978 1337300 unspecified role unspecified role prey prey not-defined-1819494077 1337301 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 5 Figure 4 trwb-trwe-2 1337299 not-defined-1971228009 1337301 unspecified role unspecified role bait bait Q04230:p.Pro18Ser Q04230-18-18 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Val74Ala Q04230-275-275 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.[Pro18Ser;Val74Ile] Q04230-252-259 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1337302 unspecified role unspecified role prey prey Q7X251:p.Thr107Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q7X251:p.Pro57Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q7X251:p.Pro57Ser mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q7X251:p.Val52Leu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 5 trwb-trwb-5 1337299 not-defined-947109725 1337301 unspecified role unspecified role bait bait Q04230:p.Lys136Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Pro18Ser Q04230-18-18 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Val74Leu Q04230-74-74 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q04230:p.Asp158Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a 1337301 unspecified role unspecified role prey prey physical association physical association false false false Table 5, Fig. 4 trwb-trwb-4 1337299 not-defined-947109725 1337301 unspecified role unspecified role prey prey Q04230:p.Pro18Ser Q04230-18-18 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Asp158Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Lys136Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q04230:p.Val74Leu Q04230-74-74 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false not-defined-947109725 1337301 unspecified role unspecified role prey prey Q04230:p.Lys136Thr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q04230:p.Asp158Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Pro18Ser Q04230-18-18 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q04230:p.Val74Leu Q04230-74-74 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 5, Fig. 4