mpidb The Microbial Protein Interaction Database bastiat-2010-1 Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bastiat B., Sauviac L., Bruand C. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation bastiat-2010-2 Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bastiat B., Sauviac L., Bruand C. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation bastiat-2010-3 Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by staining molecular weight estimation by staining weight by staining Bastiat B., Sauviac L., Bruand C. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q92k05_rhime SMc01505 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MIGKSPSSDDPNAQIAVKLKALYQSVQEEAIPARFLDLLEKLEAAEQQSALQGKE q92rv2_rhime SMc00794 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MPLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIDDLELFPAASNDRIGLYKLFCSLFEKLKIDRTQLASPFAWEQRAASNLSLIAPPQRQAFLLVALEGFSTGEAAEIMGLDQGAFGKLLTSASEEISRQIATDVMIIEDEPLIALDIEDMVTSLGHRVTGIARTRREALNLYHQTSPKMVLADIQLADGSSGIDAVNDILTQAAVPVIFITAFPERLLTGKKPEPAFLVTKPFNPETVKALISQALFFDEHAQAGAS q92n10_rhime SMc01504 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MTLSTRIAPFLPYLRRYSRALTGSQTSGDAYVAAVLEALIADTSIFPEASSDRVALFRLFTSMFGSSSVLVPEPVSPFAWEQRASVNLAAVSPLARQAFLLVSVEAFTPQEAAEVLDVDAAKLAALLDRASQEISRQVATEIMIIEDEPLIAIDIEQMVESLGHSVTGIARTKDEAIALYETTKPNMVLADIQLADGSSGIDAVNEILKTAAVPVIFITAFPERLLTGERPEPTFLVTKPFNPEMVKALISQALFFNETTKAAA q92n11_rhime RNA polymerase sigma factor SMc01506 rpoE2 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MSSENQEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFEIGTNMKAWLFTILRNELYSQMRKRGREVQDSDGHLTETLAHHPEQYGSLDLQDFRRALEQLPPDQREAIILVGASGFSYEEAATICGCALGTIKSRVNRARQRLQEILQVRGENDYGPDETSAPITSRAFVS q92rv2-q92k05 1337129 not-defined-622793850 1337132 unspecified role unspecified role prey prey not-defined-382454362 1337133 unspecified role unspecified role bait bait physical association physical association false false false table 2 q92n10-q92k05 1337129 not-defined-307517192 1337134 unspecified role unspecified role bait bait not-defined-774975221 1337132 unspecified role unspecified role prey prey physical association physical association false false false table 2 q92k05-q92rv2 1337129 not-defined-596785056 1337133 unspecified role unspecified role prey prey not-defined-502183685 1337132 unspecified role unspecified role bait bait physical association physical association false false false table 2 q92k05-q92n10 1337129 not-defined-5539710 1337134 unspecified role unspecified role prey prey not-defined-210144047 1337132 unspecified role unspecified role bait bait physical association physical association false false false table 2 q92k05-rpoe2 1337129 not-defined-1857161496 1337135 unspecified role unspecified role prey prey not-defined-742568209 1337132 unspecified role unspecified role bait bait physical association physical association false false false table 2 rpoe2-q92k05 1337129 not-defined-465925750 1337132 unspecified role unspecified role prey prey not-defined-599037358 1337135 unspecified role unspecified role bait bait physical association physical association false false false table 2 q92k05_rhime-q92n10_rhime-1 1337130 not-defined-550358673 1337134 unspecified role unspecified role prey prey region Q92N10-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false q92n10-- Q92N10-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q92N10:p.Asp191Ala Q92N10-191-191 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli not-defined-1864778052 1337132 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 4 q92k05-rpoe2-1 1337130 not-defined-1321533784 1337132 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1989539429 1337135 unspecified role unspecified role prey prey q92n11-- Q92N11-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 4A q92k05-q92rv2-1 1337131 not-defined-1192965107 1337132 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-388747791 1337133 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false figure 4 q92k05-q92n10-2 1337131 not-defined-550358673 1337134 unspecified role unspecified role prey prey region Q92N10-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli not-defined-1864778052 1337132 unspecified role unspecified role bait bait region Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 4