mpidb The Microbial Protein Interaction Database callahan-2010-4 Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation callahan-2010-1 Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. ecolx Escherichia coli cd circular dichroism CD CD cd predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation callahan-2010-2 Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation callahan-2010-3 Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation callahan-2010-5 Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation esxb_myctu ESAT-6-like protein EsxB esxB cfp10 lhp mtsA10 Rv3874 MTV027.09 10 kDa culture filtrate antigen CFP-10 Secreted antigenic protein MTSA-10 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF esxa_myctu 6 kDa early secretory antigenic target esxA esaT6 Rv3875 MTV027.10 ESAT-6 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA eccb1_myctu ESX-1 secretion system ATPase EccB1 eccB1 ESX conserved component B1 Type VII secretion system protein EccB1 Rv3869 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVVAVLILAGAALLAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRATQAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSPDPRYTESMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAALLEHDTLPADPSPRKVPAGASGAP ecc1a_myctu ESX-1 secretion system protein EccCa1 eccCa1 snm1 ESX conserved component Ca1 Type VII secretion system protein EccCa1 Rv3870 Snm1 secretory protein protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAMLGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINADRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRPANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWVVKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHPPDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLSDLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGSAYRIRVHEDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITGTILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFGHELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMTHPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTGELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDEFAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNLTYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFYISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP ecc1b_myctu ESX-1 secretion system protein EccCb1 eccCb1 snm2 ESX conserved component Cb1 Type VII secretion system protein EccCb1 Rv3871 Snm2 secretory protein protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQPLRFALGIMDEPRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMSAAATHSPRNVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDKVNRVVAEMQAVMRQRETTFKEHRVGSIGMYRQLRDDPSQPVASDPYGDVFLIIDGWPGFVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLVEAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEIPIGLRETDLTPAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQQVRFMLADYRSGLLDAVPDTHLLGAGAINRNSASLDEAVQALAVNLKKRLPPTDLTTAQLRSRSWWSGFDVVLLVDDWHMIVGAAGGMPPMAPLAPLLPAAADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLSGEKQEFPSSEFKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG espi_myctu ESX-1 secretion-associated protein EspI espI Rv3876 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAADYDKLFRPHEGMEAPDDMAAQPFFDPSASFPPAPASANLPKPNGQTPPPTSDDLSERFVSAPPPPPPPPPPPPPTPMPIAAGEPPSPEPAASKPPTPPMPIAGPEPAPPKPPTPPMPIAGPEPAPPKPPTPPMPIAGPAPTPTESQLAPPRPPTPQTPTGAPQQPESPAPHVPSHGPHQPRRTAPAPPWAKMPIGEPPPAPSRPSASPAEPPTRPAPQHSRRARRGHRYRTDTERNVGKVATGPSIQARLRAEEASGAQLAPGTEPSPAPLGQPRSYLAPPTRPAPTEPPPSPSPQRNSGRRAERRVHPDLAAQHAAAQPDSITAATTGGRRRKRAAPDLDATQKSLRPAAKGPKVKKVKPQKPKATKPPKVVSQRGWRHWVHALTRINLGLSPDEKYELDLHARVRRNPRGSYQIAVVGLKGGAGKTTLTAALGSTLAQVRADRILALDADPGAGNLADRVGRQSGATIADVLAEKELSHYNDIRAHTSVNAVNLEVLPAPEYSSAQRALSDADWHFIADPASRFYNLVLADCGAGFFDPLTRGVLSTVSGVVVVASVSIDGAQQASVALDWLRNNGYQDLASRACVVINHIMPGEPNVAVKDLVRHFEQQVQPGRVVVMPWDRHIAAGTEISLDLLDPIYKRKVLELAAALSDDFERAGRR espj_myctu ESX-1 secretion-associated protein EspJ espJ TB27.4 Rv3878 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEPLAVDPTGLSAAAAKLAGLVFPQPPAPIAVSGTDSVVAAINETMPSIESLVSDGLPGVKAALTRTASNMNAAADVYAKTDQSLGTSLSQYAFGSSGEGLAGVASVGGQPSQATQLLSTPVSQVTTQLGETAAELAPRVVATVPQLVQLAPHAVQMSQNASPIAQTISQTAQQAAQSAQGGSGPMPAQLASAEKPATEQAEPVHEVTNDDQGDQGDVQPAEVVAAARDEGAGASPGQQPGGGVPAQAMDTGAGARPAASPLAAPVDPSTPAPSTTTTL esxh_myctu ESAT-6-like protein EsxH 10 kDa antigen CFP7 Low molecular weight protein antigen 7 Protein TB10.4 MTV035.16 Rv0288 esxH cfp7 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG esxg_myctu ESAT-6-like protein EsxG Conserved protein TB9.8 LH57_01570 Rv0287 esxG protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF espa_myctu ESX-1 secretion-associated protein EspA espA Rv3616c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSRAFIIDPTISAIDGLYDLLGIGIPNQGGILYSSLEYFEKALEELAAAFPGDGWLGSAADKYAGKNRNHVNFFQELADLDRQLISLIHDQANAVQTTRDILEGAKKGLEFVRPVAVDLTYIPVVGHALSAAFQAPFCAGAMAVVGGALAYLVVKTLINATQLLKLLAKLAELVAAAIADIISDVADIIKGTLGEVWEFITNALNGLKELWDKLTGWVTGLFSRGWSNLESFFAGVPGLTGATSGLSQVTGLFGAAGLSASSGLAHADSLASSASLPALAGIGGGSGFGGLPSLAQVHAASTRQALRPRADGPVGAAAEQVGGQSQLVSAQGSQGMGGPVGMGGMHPSSGASKGTTTKKYSEGAAAGTEDAERAPVEADAGGGQKVLVRNVV esxb-eccb1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary n/a 1336715 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-eccca1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary n/a 1336716 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-eccca1-1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336716 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-ecccb1-1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336717 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-esxb 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336713 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-esxa 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336714 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-espi 1336708 not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary n/a 1336718 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1563812217 1336713 unspecified role unspecified role bait bait physical association physical association false false false Table 2 esxb-espi-1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336718 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-espj 1336708 not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary n/a 1336719 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1563812217 1336713 unspecified role unspecified role bait bait physical association physical association false false false Table 2 esxb-espj-1 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336719 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-ecccb1-2 1336708 not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary not-defined-1563812217 1336713 unspecified role unspecified role bait bait n/a 1336717 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 esxb-espj-2 1336708 not-defined-1563812217 1336713 unspecified role unspecified role bait bait not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary physical association physical association false false false Table 2 esxa-esxb-5 1336709 not-defined-29254123 1336714 unspecified role unspecified role neutral component neutral component not-defined-1563812217 1336713 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3D esxg-esxh-3 1336709 not-defined-472273158 1336720 unspecified role unspecified role neutral component neutral component not-defined-1158409817 1336721 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3D esxg-esxh-4 1336710 not-defined-1334710093 1336720 unspecified role unspecified role neutral component neutral component not-defined-58210097 1336721 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3E, Table 1 esxa-esxb-6 1336710 not-defined-29254123 1336714 unspecified role unspecified role neutral component neutral component not-defined-1563812217 1336713 unspecified role unspecified role neutral component neutral component physical association physical association false false false Table 1 esxg-esxh-2 1336711 not-defined-1334710093 1336720 unspecified role unspecified role neutral component neutral component not-defined-58210097 1336721 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3F esxa-esxb-7 1336711 not-defined-1563812217 1336713 unspecified role unspecified role neutral component neutral component not-defined-29254123 1336714 unspecified role unspecified role neutral component neutral component physical association physical association false false false Table 1 esxb-espa 1336712 not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary not-defined-1563812217 1336713 unspecified role unspecified role bait bait P9WNK5:p.Gln42Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a 1336722 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figs. 4A, 5 esxb-ecccb1 1336712 n/a 1336717 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1563812217 1336713 unspecified role unspecified role bait bait P9WNK5:p.Gln42Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false not-defined-29254123 1336714 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig. 5