mpidb The Microbial Protein Interaction Database chiang-2009-1 Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit. ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chiang Y.L., Hsieh Y.C., Fang J.Y., Liu E.H., Huang Y.C., Chuankhayan P., Jeyakanthan J., Liu M.Y., Chan S.I., Chen C.J. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation chiang-2009-2 Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit. ecoli Escherichia coli (strain K12) chromatography chromatography technology column chromatography chromatography weight by comassie molecular weight estimation by coomasie staining weight by comassie Chiang Y.L., Hsieh Y.C., Fang J.Y., Liu E.H., Huang Y.C., Chuankhayan P., Jeyakanthan J., Liu M.Y., Chan S.I., Chen C.J. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation chiang-2009-3 Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit. ecoli Escherichia coli (strain K12) dls dynamic light scattering dls predetermined predetermined participant predetermined Chiang Y.L., Hsieh Y.C., Fang J.Y., Liu E.H., Huang Y.C., Chuankhayan P., Jeyakanthan J., Liu M.Y., Chan S.I., Chen C.J. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation aprb_desgg Adenylylsulfate reductase subunit beta aprB Adenosine 5'-phosphosulfate reductase subunit beta DGI_0458 protein protein desgg Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) MPTFVDPSKCDGCKGGEKTACMYICPNDLMILDPEEMKAFNQEPEACWECYSCIKICPQGAITARPYADFAPMGGTCIPLRGSEDIMWTIKFRNGSVKRFKFPIRTTPEGSIKPFEGKPEAGDLENELLFTETALTVPQVALGQKAQIADAETSQCWFDLPCEGGNR apra_desgg Adenylylsulfate reductase subunit alpha aprA Adenosine 5'-phosphosulfate reductase subunit alpha DGI_0457 protein protein desgg Desulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) MPKIPSKETPRGVAIAEPIIVEHSVDLLMVGGGMGNCGAAFEAVRWADKYAPEAKILLVDKASLERSGAVAQGLSAINTYLGDNNADDYVRMVRTDLMGLVREDLIYDLGRHVDDSVHLFEEWGLPVWIKDEHGHNLDGAQAKAAGKSLRNGDKPVRSGRWQIMINGESYKVIVAEAAKNALGQDRIIERIFIVKLLLDKNTPNRIAGAVGFNLRANEVHIFKANAMVVACGGAVNVYRPRSVGEGMGRAWYPVWNAGSTYTMCAQVGAEMTMMENRFVPARFKDGYGPVGAWFLLFKAKATNCKGEDYCATNRAMLKPYEERGYAKGHVIPTCLRNHMMLREMREGRGPIYMDTKTALQTSFATMSPAQQKHLEAEAWEDFLDMCVGQANLWAATNCAPEERGSEIMPTEPYLLGSHSGCCGIWASGPDEAWVPEDYKVRAANGKVYNRMTTVEGLWTCADGVGASGHKFSSGSHAEGRIVGKQMVRWYLDHKDFKPEFVETAEELKTLIYRPYYNYEKGKGASTCPVVNPEYISPKNFMMRLIKCTDEYGGGVGTYYNTSKALLDTGFWLMEMLEEDSLKLAARDLHELLRCWENYHRLWTVRLHMQHIAFREESRYPGFYYRADFLGLDDSKWKCFVNSKYDPAKKETKIFKKPYYQIIPTDA d2yw41-d2yw42-2 1336546 not-defined-455191380 1336549 unspecified role unspecified role neutral component neutral component Stoichiometry: 6.0 not-defined-172185768 1336550 unspecified role unspecified role neutral component neutral component Stoichiometry: 6.0 direct interaction direct interaction false false false Table 1 3.2A Rworking = 0.19 Rfree = 0.24 d2yw41-d2yw42-3 1336547 not-defined-975103726 1336550 unspecified role unspecified role neutral component neutral component not-defined-250499954 1336549 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1 d2yw41-d2yw42-4 1336548 not-defined-975103726 1336550 unspecified role unspecified role neutral component neutral component not-defined-250499954 1336549 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1