mpidb The Microbial Protein Interaction Database lowenthal-2009-1 Functional analysis of the Helicobacter pylori flagellar switch proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lowenthal A.C., Hill M., Sycuro L.K., Mehmood K., Salama N.R., Ottemann K.M. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation b5zae7_helpg cheY HPG27_361 protein protein helpg Helicobacter pylori (strain G27) MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTND q9zm30_helpj Flagellar motor switch protein FliM fliM jhp_0393 protein protein helpj Helicobacter pylori J99 Campylobacter pylori J99 MADILSQEEIDALLEVVDENVDIQNVQKKDIIPQRSVTLYDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQNREFSDIELNLLDTILRQVMQILKEVWSPVVEMYPTIDAKESSANVVQIVAQNEISIMVVLEIIIGHSRGMMNICYPVISIESILSKMGSRDFMLSETNSKKSRNKELQALLSGVSVDMMVFLGAVELSLKEMLDLDVGDTIRLNKVANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVYSEKERTKEILEMLEEQRRGKVGDIMKIEEE flim-chey 1336501 n/a 1336502 unspecified role unspecified role prey prey helpg Helicobacter pylori (strain G27) n/a 1336503 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 4