mpidb The Microbial Protein Interaction Database gonzalez-2009-2 Divisome under construction: distinct domains of the small membrane protein FtsB are necessary for interaction with multiple cell division proteins. ecoli Escherichia coli (strain K12) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gonzalez M.D., Beckwith J. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation gonzalez-2009-1 Divisome under construction: distinct domains of the small membrane protein FtsB are necessary for interaction with multiple cell division proteins. ecoli Escherichia coli (strain K12) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gonzalez M.D., Beckwith J. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation ftsl_ecoli Cell division protein FtsL ftsL mraR b0083 JW0081 yabD protein protein ecoli Escherichia coli (strain K12) MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQK ftsb_ecoli Cell division protein FtsB ftsB b2748 JW2718 ygbQ protein protein ecoli Escherichia coli (strain K12) MGKLTLLLLAILVWLQYSLWFGKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPDASKRAQSAGQNNR ftsq_ecoli Cell division protein FtsQ ftsQ b0093 JW0091 protein protein ecoli Escherichia coli (strain K12) MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVVLGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGPEGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLARFVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ ftsb-ftsl-14 1335501 not-defined-1885363030 1335503 unspecified role unspecified role prey prey not-defined-285951507 1335504 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1335505 unspecified role unspecified role prey prey association association false false false Fig. 3 ftsb-ftsl-15 1335501 not-defined-1885363030 1335503 unspecified role unspecified role prey prey not-defined-285951507 1335504 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 3 ftsl-ftsb-3 1335502 not-defined-1885363030 1335503 unspecified role unspecified role bait bait not-defined-285951507 1335504 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3