mpidb The Microbial Protein Interaction Database parashar-2009-1 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation parashar-2009-3 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation parashar-2009-2 BldG and SCO3548 interact antagonistically to control key developmental processes in Streptomyces coelicolor. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Parashar A., Colvin K.R., Bignell D.R., Leskiw B.K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation q9x914_strco SCO3548 protein protein strco Streptomyces coelicolor A3(2) MATVELRFSALPEHVRTARLVAAAVARRAGVDEAVLDEVRLAVGEACTRAVGLHQHVGITAPVKVSLIEEEKQFSIEVGDEAPHAVPGVKTSGDAVDELEAEEDEMGLAVISGLVDDVEVSAGEDGGLIRMTWPTASAVLPPI rsbv_strco Anti-sigma-B factor antagonist Anti-anti-sigma-B factor SCH5.12c SCO3549 rsbV bldG protein protein strco Streptomyces coelicolor A3(2) MDLSLSTRTVGDRTVVEVGGEIDVYTAPKLREQLVELVNDGSFHLVVDMEGVDFLDSTGLGVLVGGLKRVRAHEGSLRLVCNQERILKIFRITGLTKVFPIHTSVEEAVAATD q9x914-q9x914 1335420 not-defined-1371845551 1335423 unspecified role unspecified role prey prey not-defined-956626386 1335423 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B rsbv-rsbv 1335420 not-defined-2127501521 1335424 unspecified role unspecified role prey prey not-defined-1005653638 1335424 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A rsbv-q9x914 1335420 not-defined-15929326 1335424 unspecified role unspecified role bait bait not-defined-1062086777 1335423 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 q9x914-rsbv 1335420 not-defined-806413734 1335424 unspecified role unspecified role prey prey not-defined-620119766 1335423 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1 q9x914-q9x914-1 1335421 not-defined-94034186 1335423 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-64343935 1335423 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 5A q9x914-rsbv-2 1335421 not-defined-15929326 1335424 unspecified role unspecified role prey prey ecolx Escherichia coli not-defined-1062086777 1335423 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 2B rsbv-rsbv-1 1335421 not-defined-1005653638 1335424 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-2127501521 1335424 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 5B rsbv-q9x914-2 1335422 not-defined-1062086777 1335423 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-15929326 1335424 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 2A