mpidb The Microbial Protein Interaction Database matsumoto-2009-1 Essential role of the SycP chaperone in type III secretion of the YspP effector. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Matsumoto H., Young G.M. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation matsumoto-2009-2 Essential role of the SycP chaperone in type III secretion of the YspP effector. yere8 Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) pull down pull down western blot western blot Immuno blot Immuno blot Matsumoto H., Young G.M. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation matsumoto-2009-3 Essential role of the SycP chaperone in type III secretion of the YspP effector. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Matsumoto H., Young G.M. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation a1jtb1_yere8 YE4195 protein protein yere8 Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) MFICELNCTESGNEYSRQLSIYRDEIEQNLCFALSGQNELPTLIAGDFLTLLCEQALQPLNSGLGIGIFPGSRILTVYKKVSLAGYYQGSLNQLLSKLMTSIEEWDNRLITA a1jtb0_yere8 Protein-tyrosine-phosphatase YE4194 protein protein yere8 Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) MLTKNIAPTPEMVKIVTSVLDNKIKLQQIDFNGKKYTISIDNGKCVSLTRDDKKWYKSVCDFFSRGLTSGQSAFTPRAYQLKMAVDEVLILNKKEPINISLNELNASVITKVEDKINSETDILWENLLKFNNENQYLSTLGDTNRYKDIKARISTQLNKNLNANKISIAENHIANAGQYPKDEQIEDHLKMLADNKTSCLVVLASNDDISKPKFTNYFIPNSSYATSTLVVKKYNLSSDVLADSYVLKTKDSKGKYIDIPVFHVTNWPDKKPIPSSALIEMADLVTKSAKINNKINKISVNSFDKGLPFVHCKAGVGRTGTFIAEYYMSNHPDNNVSLERIIEDMRTSRNNHMVQKIEQLDTLVEICKAQNRPIFKSDEKLNLSVPKPIYVNIIKK a1jtb1-a1jtb1 1335036 not-defined-700444323 1335039 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 4A a1jtb1-a1jtb0 1335037 not-defined-1800597148 1335039 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-532585722 1335040 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4B a1jtb1-a1jtb0-1 1335038 not-defined-640261322 1335039 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1133679059 1335040 unspecified role unspecified role prey prey yere8 Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) physical association physical association false false false Fig. 4C