mpidb The Microbial Protein Interaction Database dangel-2009-1 Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation dangel-2009-2 Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa western blot western blot Immuno blot Immuno blot Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation dangel-2009-3 Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation probe-0 Probe-0 ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GATTGGATCCACCATTTCCAAATTCCCGAACAG f5m310_rhosh RSWS8N_13030 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR The sequence has been withdrawn from uniprot. cbbr_cersp HTH-type transcriptional regulator CbbR RuBisCO operon transcriptional regulator cbbR protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MVRLDAITLKQLRALVAVAGSASLTGGATRLGLTPPAIHSQIRNLEEAFGVPLLHRPPETGSFTPTLAGIAVLEAAQRIEVILSQCSYQVMAVSEGRAGQVTLGVVSTGRYFAPRLVKMLSLACPEIRIALRVGNREQLIDDLARHMVDLAVMGRPPRQPEVASVALGPHPHGIVAPPDHPLAGLAEVPVPDLLSQTFLARAEGSGTRVLMSRYLDRLGEGQVVDLIEMDSNETIKQSVIAGLGLAFLSLHVVMDELRFGQLVQLAAPGLPIERHWFLVHPVDRPLNPAALRVQGEIVKLKGAYLPGAPA rega_cers4 Photosynthetic apparatus regulatory protein RegA Response regulator PrrA prrA RSP_1518 RHOS4_00930 regA protein protein rhos4 Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR probe_0-cbbr-1 1335011 n/a 1335014 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1335015 unspecified role unspecified role prey prey not-defined-629946318 1335016 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 probe_0-cbbr-2 1335011 n/a 1335014 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-629946318 1335016 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4 probe_0-cbbr-3 1335012 n/a 1335014 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1335015 unspecified role unspecified role prey prey not-defined-629946318 1335016 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 cbbr-rega-1 1335013 not-defined-1838870539 1335017 unspecified role unspecified role neutral component neutral component not-defined-1472137289 1335016 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 6 Cross-linking occured in the presence of DNA.