mpidb The Microbial Protein Interaction Database garg-2009-1 The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation garg-2009-2 The YjbH protein of Bacillus subtilis enhances ClpXP-catalyzed proteolysis of Spx. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Garg S.K., Kommineni S., Henslee L., Zhang Y., Zuber P. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation spx_bacsu Global transcriptional regulator Spx spx Redox-responsive transcription factor Spx Suppressor of clpP and clpX spxA yjbD BSU11500 protein protein bacsu Bacillus subtilis MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN spxh_bacsu ClpXP adapter protein SpxH spxH yjbH BSU11550 protein protein bacsu Bacillus subtilis MTNYQHELYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASASLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRKAGMQFLRNMQESLFVSKKNITDENVLLEIAENTSLDLEEFKKDLHSQSAVKALQCDMKIAAEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEYFRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK spxa-yjbh 1334998 not-defined-1565811105 1335000 unspecified role unspecified role bait bait not-defined-1542656185 1335001 unspecified role unspecified role prey prey o31606-1-24 O31606-1-24 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1A spxa-yjbh-1 1334999 not-defined-1131344528 1335000 unspecified role unspecified role neutral component neutral component not-defined-471617300 1335001 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Thiol oxidant diamide. Figs. 1C, 1D