mpidb The Microbial Protein Interaction Database medhekar-2009-1 Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation medhekar-2009-2 Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation medhekar-2009-3 Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation medhekar-2009-4 Bordetella Bsp22 forms a filamentous type III secretion system tip complex and is immunoprotective in vitro and in vivo. in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Medhekar B., Shrivastava R., Mattoo S., Gingery M., Miller J.F. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation q9rez6_borbo bopD protein protein borbo Bordetella bronchiseptica MSVSPTSPGSFGAGPVFDSELQAPAPSAQRRGGAAPVPPPVDRRGVEPGDPTLGMLPAPDLLAGGAVSRTRAALDDLDAARLGEDIYTLMAVLQQASQQMREAARIARDAEATRQTQAIGDAASQMRQAANERMAGAIVAGAMQIAGGFVQLGAGLAAGLQAMGGAAAQAKGAAFSEQASTSRKVAAGLHDAPELQATVQARATQLEAQAASFGADAARSSAKSQRVSSVAQAGAATAGGIGGLTSAAQERRAAEHEARRAELDVEAKVHETASRRADEAMQQMLDIIRGIREKLAGMEQSRSETARSVARNI q9rez5_borbo bopB protein protein borbo Bordetella bronchiseptica MTVMSTTISTAPSGAALAPSRIDMRAPEPGSAGEGAGILAPVTTLALAAGRPAFPASPSLRTAPVLDPPVRDLSPADLADLLRVLRSRAVDGQLATARENLQDAQVKAKQNTQAQLDKLDAWFRKAEEAESKGWLSKVFGWIGKVLAVVASALAVGFAAVASVATGAAATPMLLLSGMALVSAVTSLADQISQEAGGPPISLGGFLSGLAGRLLTALGVDQSQADQIAKIVAGLAVPVVLLIEPQMLGEMAQGVARLAGASDATAGYIAMAMSIVAAIAVAAINAAGTAGAGSASAIKGAWDRAAAVATQVLQGGTAVAQGGVGVSMAVDRKQADFLLADKADLAASLTKLRAAMEREADDIKKILAQFDEAYHMIAKMISDMASTHSQVSANLGRRQAV q9rez7_borbo bsp22 protein protein borbo Bordetella bronchiseptica MTIDLGVSLTSQAGGLQGIDLKSMDIQTLMVYVQGRRAELLTAQMQTQAEVVQKANERMAQLNEVLSALSRAKAEFPPNPKPGDTIPGWDNQKVSRIEVPLNDALRAAGLTGMFEARDGQVTAPGGRGTQVVNGTGVMAGSTTYKELESAYTTVKGMLDTASNTQQMDMIRLQAASNKRNEAFEVMTNTEKRRSDLNSSITNNMR bopd-bopb 1334898 not-defined-801694600 1334902 unspecified role unspecified role bait bait not-defined-331963442 1334903 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A bopd-bsp22 1334898 not-defined-1434080789 1334902 unspecified role unspecified role bait bait not-defined-1179736317 1334904 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A bsp22-bsp22 1334898 n/a 1334904 unspecified role unspecified role bait bait n/a 1334904 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A bsp22-bopd 1334899 not-defined-1736701182 1334902 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1262197398 1334904 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2B bsp22-bsp22-1 1334899 n/a 1334904 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1334904 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2B bsp22-bsp22-3 1334900 n/a 1334904 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1334904 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 3C bsp22-bsp22-4 1334901 n/a 1334904 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1334904 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 3C