mpidb The Microbial Protein Interaction Database epstein-2009-1 Spatial clustering of the curlin secretion lipoprotein requires curli fiber assembly. ecoli Escherichia coli (strain K12) comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Epstein E.A., Reizian M.A., Chapman M.R. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation csgg_ecoli Curli production assembly/transport component CsgG JW1020 b1037 csgG protein protein ecoli Escherichia coli (strain K12) MQRLFLLVAVMLLSGCLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRHMSVPPES csgg-csgg-1 1334599 not-defined-299683924 1334600 unspecified role unspecified role neutral component neutral component not-defined-1098450077 1334600 unspecified role unspecified role neutral component neutral component physical association physical association false false false figure 5