mpidb The Microbial Protein Interaction Database schilhabel-2009-1 The ether-cleaving methyltransferase system of the strict anaerobe Acetobacterium dehalogenans: analysis and expression of the encoding genes. ecolx Escherichia coli bn-page blue native page bn-page weight silver stain molecular weight estimation by silver staining weight silver stain Schilhabel A., Studenik S., Vödisch M., Kreher S., Schlott B., Pierik A.J., Pierik A.Y., Diekert G. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation b8r2m5_9firm odmC protein protein acetobacterium dehalogenans Acetobacterium dehalogenans MSSLNTIRVFFPLLDKSVMIEAGKTVAQACALVGFPQNLVCGGKGTCKKCLVTIRENDLVSEVLGCQHLISEDMAILISKEAALSQILETTENGELSFNPKTRVVTIPITALKTEMCSYDLETIRNVLEMPVKMSSIKVLQKSAEVFHQKNLPLMNFILYNDEIIDLIPGDKELNAYGVAFDIGTTSVVGYLYDLTNGVLIHQYSSLNKQISFGGDVISRIDYASTAPENLKSIQHAIIETVNNILSNLFYESKIPSEAVYECVFCGNSTMAHLFLGLNPLHLGLSPFTGITRDMVVLNAEELGININPTGKITFLPLLGGFVGADTTAVLLGLPKDDEYRLMIDLGTNGEIAVGNRNRYFVASTACGPALEGAGIHMGMRGTTGAIEKITLVDNEIKCHVIGNAAPLGFCGSGIIDAIAFLYREKLIYNRGNFIKGEDLDNHPFKDRFKTDENNQRYFIFVRHQDNPNGKEMVITQKDVRAVQLAKAAIFTGCCLLTEKYGIKAADLKEITLAGAFGNYIDIENAQFIGLLPEISGVPIRSIGNGAGTGSQLFLLSQDEAQRCEAIPKITTHIELATDPNFSNLYMQNTTLGQNEMK o87603_9firm odmA protein protein acetobacterium dehalogenans Acetobacterium dehalogenans MSKIEEVKAKVEVGKSKLVPGLVQEALDEGSAPGEILQAMVDSMGVVGEKFSSGEIFVPEMLIAAKAMSKGVEVLKPLMAGDGSASLGTCVIGTVAGDLHDIGKNLVSMMIESAGFDMVDLGVDVPADTFVQAVKDNTNVKLVACSGLLTTTMPALKEAVQTIKAAYPDMKVIVGGAPVTPEYAAEVGADGYAPDAGSAAVKARELATA odma-odmc 1334588 not-defined-1795796669 1334589 unspecified role unspecified role neutral component neutral component c-terminal strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli Stoichiometry: 2.0 not-defined-422958398 1334590 unspecified role unspecified role neutral component neutral component c-terminal strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli Stoichiometry: 2.0 direct interaction direct interaction false false false figure 7 Vitamin B12 odmc-odmc 1334588 not-defined-1795796669 1334589 unspecified role unspecified role neutral component neutral component c-terminal strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli Stoichiometry: 2.0 direct interaction direct interaction false false false figure 7